Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|083170
Gene name
Locationscaffold_5:1231961..1234874
Strand-
Gene length (bp)2913
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 2.5E-14 676 708

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 657 711 1.0E-12
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 675 753 3.0E-12
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 609 726 6.0E-12
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 676 711 8.0E-12
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 666 716 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 657 711 1.0E-12
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 675 753 3.0E-12
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 609 726 6.0E-12
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 676 711 8.0E-12
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 666 716 4.0E-11
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 676 707 1.0E-10
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 676 717 3.0E-10
sp|Q55EQ0|GTAF_DICDI GATA zinc finger domain-containing protein 6 OS=Dictyostelium discoideum GN=gtaF PE=3 SV=1 647 711 1.0E-09
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 654 705 2.0E-09
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 676 713 2.0E-09
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 676 720 2.0E-09
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 661 707 2.0E-09
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 676 711 3.0E-09
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 676 711 9.0E-09
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 665 713 5.0E-08
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 676 707 1.0E-07
sp|Q54V37|GTAT_DICDI GATA zinc finger domain-containing protein 20 OS=Dictyostelium discoideum GN=gtaT PE=3 SV=1 673 711 3.0E-07
sp|Q9FH57|GATA5_ARATH GATA transcription factor 5 OS=Arabidopsis thaliana GN=GATA5 PE=2 SV=1 675 705 9.0E-07
sp|Q5Z4U5|GAT20_ORYSJ GATA transcription factor 20 OS=Oryza sativa subsp. japonica GN=GATA20 PE=2 SV=1 675 718 9.0E-07
sp|Q54FV1|GTAX_DICDI GATA zinc finger domain-containing protein 24 OS=Dictyostelium discoideum GN=gtaX PE=3 SV=2 663 711 1.0E-06
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 665 706 1.0E-06
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 657 711 2.0E-06
sp|Q9SD38|GATA6_ARATH GATA transcription factor 6 OS=Arabidopsis thaliana GN=GATA6 PE=2 SV=1 676 705 5.0E-06
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 666 723 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003677 DNA binding No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1909 0.9485 0.0344 0.0205 0.0351 0.0009 0.0454 0.0217 0.0283 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup682
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|083170
Agaricus bisporus var bisporus H39 AgabiH39|095750
Agaricus bisporus var bisporus H97 AgabiH97|083170 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|095750
Rhodonia placenta FPRL280 RhoplFPRL280|25_13
Rhodonia placenta FPRL280 RhoplFPRL280|7_38

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|083170
MASAQHAAQHPRYPLNTYSNSDSLRLPSLKDLNFYRPPPGDPNAPPNDFVQNDVARHVQWSRPGQSAPMQPGMPP
HSQHAQPQSQPQPQQHSPNSRDMGHQPVEYSKHDAVYARPGMPLSAQVAPVLGSVSSGPPARGDDPPPQSPHQPR
RPRPPPANINAARDGRPSHTAYPAQYNGYPSNQPPSSSPYHQMPSQNHSPHSAAPSQPEQLNHNAPASSHPNYNG
YSQQHYVQTRQPGHPSHAPQHPQAYHQQSLQHQNTSHPTPPSHHALHVHPSQQQQQQQQHQHQHQQQQHQQQQPT
ASSNPPSVHPSSLLQPPHPSQQAPHHTSQHQSSSGSHQPQQQQLPNHAPHGNPYPSPNSSVHPPQSPWPPSSHSQ
PPHHQPPPAPSHAQQTQQALSQSVHHHHPPPPVSSHHHHQTNALPPSTPQTIIPSQHQHAPPPQSLPPSQTQHHP
PQHSQAQAPNPHHASQPQLPQSQPHPPPQQQQLPFTRTAPLVPTNLESRNAHYPPAASSAPEVKHVPDHSDPMNE
QIVEHCNSLCLFAQHYVAAAQQSMQPPQPSPAELQDMSQKALQVVRLLEEFKRAHVPDSERNKLGDSMYEASEDH
RAPKRPWEDMVQGGNNADSPEGQYALGADKGQTTAEQDMEMIRSKRASSTAGANTTAGQTKSKYRKRSRATPPGK
CHSCNIRETPEWRRGPDGARTLCNACGLHYAKLMRKRDKTDPTGQTPRIDLETLRASARAAESSDKSRSKNKNAA
EPSSPTDSKSSSQQHHQGSFQLMNVMAQEPNSSSESNRTIPPPQASQPPPPVAQSAPSTIPVPPWSTPVQHSQPP
SSVAGPPSVHGRSYPEHLQHQSFMRSSQHSSVPQASSR*
Coding >AgabiH97|083170
ATGGCCTCCGCCCAACATGCCGCACAGCATCCCCGCTATCCCTTGAACACTTACTCAAACTCGGACTCCCTCCGC
CTCCCCTCCCTCAAGGACCTCAACTTTTATCGCCCGCCCCCCGGCGACCCCAACGCACCCCCAAACGACTTTGTC
CAAAACGATGTTGCTCGCCATGTCCAGTGGTCGCGCCCCGGCCAGTCCGCCCCCATGCAGCCCGGAATGCCTCCT
CACTCCCAACATGCTCAGCCCCAGTCCCAGCCCCAGCCCCAACAGCACTCCCCCAACTCTCGCGACATGGGACAC
CAGCCAGTGGAGTACAGCAAGCATGACGCCGTCTATGCGCGCCCCGGTATGCCCCTCTCGGCCCAAGTGGCACCC
GTTCTAGGCTCTGTCAGTTCCGGCCCACCCGCGCGTGGTGATGATCCACCTCCTCAGTCGCCCCATCAACCAAGA
AGGCCCCGGCCACCTCCAGCAAATATTAATGCTGCTCGTGATGGGCGCCCTTCCCACACCGCGTATCCAGCGCAG
TACAATGGCTATCCATCAAATCAACCCCCGTCAAGTAGTCCTTACCATCAGATGCCTAGTCAGAATCATTCTCCC
CATTCAGCTGCGCCGTCACAACCGGAGCAGCTGAATCATAATGCCCCTGCTTCCAGCCATCCCAATTATAATGGT
TACTCGCAGCAGCACTATGTACAAACCCGGCAGCCAGGTCATCCCTCGCACGCTCCCCAACACCCCCAGGCGTAC
CATCAACAATCACTTCAACATCAAAATACATCACACCCCACACCGCCATCCCACCATGCCCTTCATGTTCACCCC
TCCCAGCAGCAGCAACAACAACAACAACACCAACACCAACACCAGCAGCAACAACACCAGCAGCAGCAGCCAACG
GCATCATCAAACCCACCCTCTGTACACCCGTCGTCGCTTCTTCAACCTCCGCACCCCAGCCAGCAAGCGCCGCAT
CATACTTCACAACATCAATCTTCGTCGGGCTCGCATCAACCCCAACAACAGCAACTTCCGAATCATGCCCCACAC
GGTAACCCCTACCCTTCGCCTAATTCGAGCGTCCATCCACCGCAGAGTCCTTGGCCACCGTCAAGTCATTCTCAA
CCACCCCATCACCAACCACCCCCCGCCCCTTCACACGCCCAGCAAACCCAACAAGCCCTTTCACAGTCGGTTCAT
CATCATCACCCCCCTCCCCCGGTATCTAGTCATCATCATCATCAAACGAATGCCTTGCCGCCTTCCACTCCCCAA
ACGATCATTCCATCCCAACACCAGCATGCGCCTCCGCCGCAGTCTCTGCCACCGTCACAGACTCAGCACCATCCG
CCTCAACACTCTCAGGCCCAAGCGCCAAACCCTCATCACGCTAGTCAGCCCCAGCTACCTCAATCCCAACCGCAT
CCGCCACCTCAGCAGCAGCAATTGCCATTCACGAGGACGGCGCCTCTTGTGCCAACGAATCTTGAATCGCGAAAT
GCTCACTACCCACCGGCTGCATCATCAGCCCCTGAGGTAAAGCATGTTCCAGATCATAGCGATCCTATGAATGAG
CAGATCGTTGAACACTGCAACTCGCTGTGCTTGTTTGCTCAGCACTACGTAGCTGCAGCACAGCAAAGCATGCAA
CCACCCCAACCATCGCCCGCGGAACTCCAAGATATGTCGCAGAAAGCTTTGCAAGTCGTCCGACTTTTAGAAGAA
TTTAAGCGAGCGCATGTTCCTGATAGTGAACGCAACAAGTTAGGTGACTCCATGTATGAAGCTTCGGAAGACCAT
CGGGCACCTAAACGACCATGGGAGGATATGGTACAGGGAGGCAATAACGCCGACTCACCCGAAGGACAATATGCT
CTGGGTGCTGATAAAGGTCAGACGACCGCTGAACAAGATATGGAGATGATTCGCAGTAAACGGGCCAGTAGTACT
GCTGGAGCCAATACTACTGCTGGTCAGACTAAAAGCAAATACAGAAAAAGAAGTCGGGCCACACCTCCTGGAAAA
TGTCATTCATGCAATATCCGAGAGACTCCTGAGTGGAGGAGAGGACCGGATGGCGCGCGTACGTTATGCAACGCG
TGCGGACTTCATTATGCAAAACTTATGCGCAAACGTGACAAAACTGACCCGACCGGTCAGACTCCACGTATTGAC
CTCGAGACACTGCGTGCCTCTGCTAGAGCAGCCGAATCCTCTGACAAGTCGCGTTCAAAAAACAAAAACGCTGCG
GAACCTTCCTCCCCAACGGATTCAAAATCTAGTTCCCAGCAACATCACCAAGGGTCTTTTCAGCTCATGAATGTC
ATGGCACAAGAACCCAATTCATCGTCAGAGTCTAATCGAACCATTCCTCCTCCTCAAGCATCCCAACCTCCCCCG
CCTGTTGCGCAAAGTGCTCCGAGTACTATACCCGTGCCCCCTTGGTCCACACCCGTCCAGCATTCACAACCACCA
TCATCCGTAGCTGGGCCCCCTTCCGTTCACGGGCGTAGTTACCCTGAACATCTTCAGCACCAATCATTCATGCGA
AGCTCTCAGCATTCCTCAGTGCCCCAAGCCTCTTCCCGTTGA
Transcript >AgabiH97|083170
ATGGCCTCCGCCCAACATGCCGCACAGCATCCCCGCTATCCCTTGAACACTTACTCAAACTCGGACTCCCTCCGC
CTCCCCTCCCTCAAGGACCTCAACTTTTATCGCCCGCCCCCCGGCGACCCCAACGCACCCCCAAACGACTTTGTC
CAAAACGATGTTGCTCGCCATGTCCAGTGGTCGCGCCCCGGCCAGTCCGCCCCCATGCAGCCCGGAATGCCTCCT
CACTCCCAACATGCTCAGCCCCAGTCCCAGCCCCAGCCCCAACAGCACTCCCCCAACTCTCGCGACATGGGACAC
CAGCCAGTGGAGTACAGCAAGCATGACGCCGTCTATGCGCGCCCCGGTATGCCCCTCTCGGCCCAAGTGGCACCC
GTTCTAGGCTCTGTCAGTTCCGGCCCACCCGCGCGTGGTGATGATCCACCTCCTCAGTCGCCCCATCAACCAAGA
AGGCCCCGGCCACCTCCAGCAAATATTAATGCTGCTCGTGATGGGCGCCCTTCCCACACCGCGTATCCAGCGCAG
TACAATGGCTATCCATCAAATCAACCCCCGTCAAGTAGTCCTTACCATCAGATGCCTAGTCAGAATCATTCTCCC
CATTCAGCTGCGCCGTCACAACCGGAGCAGCTGAATCATAATGCCCCTGCTTCCAGCCATCCCAATTATAATGGT
TACTCGCAGCAGCACTATGTACAAACCCGGCAGCCAGGTCATCCCTCGCACGCTCCCCAACACCCCCAGGCGTAC
CATCAACAATCACTTCAACATCAAAATACATCACACCCCACACCGCCATCCCACCATGCCCTTCATGTTCACCCC
TCCCAGCAGCAGCAACAACAACAACAACACCAACACCAACACCAGCAGCAACAACACCAGCAGCAGCAGCCAACG
GCATCATCAAACCCACCCTCTGTACACCCGTCGTCGCTTCTTCAACCTCCGCACCCCAGCCAGCAAGCGCCGCAT
CATACTTCACAACATCAATCTTCGTCGGGCTCGCATCAACCCCAACAACAGCAACTTCCGAATCATGCCCCACAC
GGTAACCCCTACCCTTCGCCTAATTCGAGCGTCCATCCACCGCAGAGTCCTTGGCCACCGTCAAGTCATTCTCAA
CCACCCCATCACCAACCACCCCCCGCCCCTTCACACGCCCAGCAAACCCAACAAGCCCTTTCACAGTCGGTTCAT
CATCATCACCCCCCTCCCCCGGTATCTAGTCATCATCATCATCAAACGAATGCCTTGCCGCCTTCCACTCCCCAA
ACGATCATTCCATCCCAACACCAGCATGCGCCTCCGCCGCAGTCTCTGCCACCGTCACAGACTCAGCACCATCCG
CCTCAACACTCTCAGGCCCAAGCGCCAAACCCTCATCACGCTAGTCAGCCCCAGCTACCTCAATCCCAACCGCAT
CCGCCACCTCAGCAGCAGCAATTGCCATTCACGAGGACGGCGCCTCTTGTGCCAACGAATCTTGAATCGCGAAAT
GCTCACTACCCACCGGCTGCATCATCAGCCCCTGAGGTAAAGCATGTTCCAGATCATAGCGATCCTATGAATGAG
CAGATCGTTGAACACTGCAACTCGCTGTGCTTGTTTGCTCAGCACTACGTAGCTGCAGCACAGCAAAGCATGCAA
CCACCCCAACCATCGCCCGCGGAACTCCAAGATATGTCGCAGAAAGCTTTGCAAGTCGTCCGACTTTTAGAAGAA
TTTAAGCGAGCGCATGTTCCTGATAGTGAACGCAACAAGTTAGGTGACTCCATGTATGAAGCTTCGGAAGACCAT
CGGGCACCTAAACGACCATGGGAGGATATGGTACAGGGAGGCAATAACGCCGACTCACCCGAAGGACAATATGCT
CTGGGTGCTGATAAAGGTCAGACGACCGCTGAACAAGATATGGAGATGATTCGCAGTAAACGGGCCAGTAGTACT
GCTGGAGCCAATACTACTGCTGGTCAGACTAAAAGCAAATACAGAAAAAGAAGTCGGGCCACACCTCCTGGAAAA
TGTCATTCATGCAATATCCGAGAGACTCCTGAGTGGAGGAGAGGACCGGATGGCGCGCGTACGTTATGCAACGCG
TGCGGACTTCATTATGCAAAACTTATGCGCAAACGTGACAAAACTGACCCGACCGGTCAGACTCCACGTATTGAC
CTCGAGACACTGCGTGCCTCTGCTAGAGCAGCCGAATCCTCTGACAAGTCGCGTTCAAAAAACAAAAACGCTGCG
GAACCTTCCTCCCCAACGGATTCAAAATCTAGTTCCCAGCAACATCACCAAGGGTCTTTTCAGCTCATGAATGTC
ATGGCACAAGAACCCAATTCATCGTCAGAGTCTAATCGAACCATTCCTCCTCCTCAAGCATCCCAACCTCCCCCG
CCTGTTGCGCAAAGTGCTCCGAGTACTATACCCGTGCCCCCTTGGTCCACACCCGTCCAGCATTCACAACCACCA
TCATCCGTAGCTGGGCCCCCTTCCGTTCACGGGCGTAGTTACCCTGAACATCTTCAGCACCAATCATTCATGCGA
AGCTCTCAGCATTCCTCAGTGCCCCAAGCCTCTTCCCGTTGA
Gene >AgabiH97|083170
ATGGCCTCCGCCCAACATGCCGCACAGCATCCCCGCTATCCCTTGAACACTTACTCAAACTCGGACTCCCTCCGC
CTCCCCTCCCTCAAGGACCTCAACTTTTATCGCCCGCCCCCCGGCGACCCCAACGCACCCCCAAACGACTTTGTC
CAAAACGATGTTGCTCGCCATGTCCAGTGGTCGCGCCCCGGCCAGTCCGCCCCCATGCAGCCCGGAATGCCTCCT
CACTCCCAACATGCTCAGCCCCAGTCCCAGCCCCAGCCCCAACAGCACTCCCCCAACTCTCGCGACATGGGACAC
CAGCCAGTGGAGTACAGCAAGCATGACGCCGTCTATGCGCGCCCCGGTATGCCCCTCTCGGCCCAAGTGGCACCC
GTTCTAGGCTCTGTCAGTTCCGGCCCACCCGCGCGTGGTGATGATCCACCTCCTCAGTCGCCCCATCAACCAAGA
AGGCCCCGGCCACCTCCAGCAAATATTAATGCTGCTCGTGATGGGCGCCCTTCCCACGTACGTTTCATTTTATCT
TTGCTTCTGGCCCTTGTCAGTCAACTCTATATGTTTTCAGACCGCGTATCCAGCGCAGTACAATGGCTATCCATC
AAATCAACCCCCGTCAAGTAGTCCTTACCATCAGATGCCTAGTCAGAATCATTCTCCCCATTCAGCTGCGCCGTC
ACAACCGGAGCAGCTGAATCATAATGCCCCTGCTTCCAGCCATCCCAATTATAATGGTTACTCGCAGCAGCACTA
TGTACAAACCCGGCAGCCAGGTCATCCCTCGCACGCTCCCCAACACCCCCAGGCGTACCATCAACAATCACTTCA
ACATCAAAATACATCACACCCCACACCGCCATCCCACCATGCCCTTCATGTTCACCCCTCCCAGCAGCAGCAACA
ACAACAACAACACCAACACCAACACCAGCAGCAACAACACCAGCAGCAGCAGCCAACGGCATCATCAAACCCACC
CTCTGTACACCCGTCGTCGCTTCTTCAACCTCCGCACCCCAGCCAGCAAGCGCCGCATCATACTTCACAACATCA
ATCTTCGTCGGGCTCGCATCAACCCCAACAACAGCAACTTCCGAATCATGCCCCACACGGTAACCCCTACCCTTC
GCCTAATTCGAGCGTCCATCCACCGCAGAGTCCTTGGCCACCGTCAAGTCATTCTCAACCACCCCATCACCAACC
ACCCCCCGCCCCTTCACACGCCCAGCAAACCCAACAAGCCCTTTCACAGTCGGTTCATCATCATCACCCCCCTCC
CCCGGTATCTAGTCATCATCATCATCAAACGAATGCCTTGCCGCCTTCCACTCCCCAAACGATCATTCCATCCCA
ACACCAGCATGCGCCTCCGCCGCAGTCTCTGCCACCGTCACAGACTCAGCACCATCCGCCTCAACACTCTCAGGC
CCAAGCGCCAAACCCTCATCACGCTAGTCAGCCCCAGCTACCTCAATCCCAACCGCATCCGCCACCTCAGCAGCA
GCAATTGCCATTCACGAGGACGGCGCCTCTTGTGCCAACGAATCTTGAATCGCGAAATGCTCACTACCCACCGGC
TGCATCATCAGCCCCTGAGGTAAAGCATGTTCCAGATCATAGCGATCCTATGAATGAGGTAGATATAGTAACTAC
TTTGTTATGTCATCGTTGTATTAACATTCAACTGGAGCAGATCGTTGAACACTGCAACTCGCTGTGCTTGTTTGC
TCAGCACTACGGTAAATTCCTATATGTTATTTCCAAACATTTTTTTTTACTAAACTTCAATAGTAGCTGCAGCAC
AGCAAAGCATGCAACCACCCCAACCATCGCCCGCGGAACTCCAAGATATGTCGCAGAAAGCTTTGCAAGTCGTCC
GACTTTTAGAAGAATTTAAGCGAGCGCATGTTCCTGATAGTGAACGCAACAAGTTAGGTGACTCCATGTATGAAG
CTTCGGAAGACCATCGGGCACCTAAACGACCATGGGAGGATATGGTACAGGGAGGCAATAACGCCGACTCACCCG
AAGGAGTAAGCCGTCTCCTCGTTTGGAGTGTCACCACACGTCTGACTATTTTAGCAATATGCTCTGGGTGCTGAT
AAAGGTCAGACGACCGCTGAACAAGATATGGAGATGATTCGCAGTAAACGGGCCAGTAGTACTGCTGGAGCCAAT
ACTACTGCTGGTCAGACTAAAAGCAAATACAGAAAAAGAAGTGTAAGCTATGCCATCCGTCCAGTCACTTTCTAA
AGTTTAATAGTCGTCGTCCTTGACAGCGGGCCACACCTCCTGGAAAATGTCATTCATGCAATATCCGAGAGACTC
CTGAGTGGAGGAGAGGACCGGATGGCGCGCGTACGTTATGCAACGCGTGCGGACTTCGTACGTATTTGCGACTGA
GATGTTTTCAAGACCTAACTCATCTATGAAGATTATGCAAAACTTATGCGCAAACGTGACAAAACTGACCCGACC
GGTCAGACTCCACGTATTGACCTCGAGACACTGCGTGCCTCTGCTAGAGCAGCCGAATCCTCTGACAAGTCGCGT
TCAAAAAACAAAAACGCTGCGGAACCTTCCTCCCCAACGGATTCAAAATCTAGTTCCCAGCAACATCACCAAGGG
TCTTTTCAGCTCATGAATGTCATGGCACAAGAACCCAATTCATCGTCAGAGTCTAATCGAACCATTCCTCCTCCT
CAAGCATCCCAACCTCCCCCGCCTGTTGCGCAAAGTGCTCCGAGTACTATACCCGTGCCCCCTTGGTCCACACCC
GTCCAGCATTCACAACCACCATCATCCGTAGCTGGGCCCCCTTCCGTTCACGGGCGTAGTTACCCTGAACATCTT
CAGCACCAATCATTCATGCGAAGCTCTCAGCATTCCTCAGTGCCCCAAGCCTCTTCCCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail