Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082990
Gene name
Locationscaffold_5:1197760..1198476
Strand+
Gene length (bp)716
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 66.52 33.51 99.52
Initials Initials knots 6.36 2.28 10.45
Pileal_Stipeal_center Stage I stipe center 5.90 2.07 9.72
Pileal_Stipeal_shell Stage I stipe shell 4.24 1.32 7.16
DIF_stipe_center Stage II stipe center 4.61 1.48 7.74
DIF_stipe_shell Stage II stipe shell 6.62 2.38 10.86
DIF_stipe_skin Stage II stipe skin 6.01 1.95 10.07
DIF_cap_skin Stage II cap skin 2.57 0.59 4.55
DIF_cap_tissue Stage II cap tissue 4.10 1.25 6.94
DIF_gill_tissue Stage II gill tissue 5.92 2.07 9.78
YFB_stipe_center Young fruiting body stipe center 4.90 1.56 8.24
YFB_stipe_shell Young fruiting body stipe shell 8.30 3.07 13.52
YFB_stipe_skin Young fruiting body stipe skin 8.24 3.18 13.29
YFB_cap_skin Young fruiting body cap skin 3.14 0.79 5.50
YFB_cap_tissue Young fruiting body cap tissue 5.33 1.79 8.86
YFB_gill_tissue Young fruiting body gill tissue 3.15 0.80 5.49
YFB_veil Young fruiting body veil 2.70 0.62 4.79

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.798401 no
DIF_gill_tissue YFB_stipe_shell 0.559836 no
DIF_gill_tissue YFB_stipe_skin 0.556243 no
DIF_gill_tissue YFB_cap_skin 0.222470 no
DIF_gill_tissue YFB_cap_tissue 0.897656 no
DIF_gill_tissue YFB_gill_tissue 0.222923 no
DIF_gill_tissue YFB_veil 0.111025 no
YFB_stipe_center YFB_stipe_shell 0.302307 no
YFB_stipe_center YFB_stipe_skin 0.300978 no
YFB_stipe_center YFB_cap_skin 0.466664 no
YFB_stipe_center YFB_cap_tissue 0.925025 no
YFB_stipe_center YFB_gill_tissue 0.473191 no
YFB_stipe_center YFB_veil 0.283169 no
YFB_stipe_shell YFB_stipe_skin 0.992397 no
YFB_stipe_shell YFB_cap_skin 0.043983 yes
YFB_stipe_shell YFB_cap_tissue 0.390800 no
YFB_stipe_shell YFB_gill_tissue 0.037818 yes
YFB_stipe_shell YFB_veil 0.017783 yes
YFB_stipe_skin YFB_cap_skin 0.042041 yes
YFB_stipe_skin YFB_cap_tissue 0.390721 no
YFB_stipe_skin YFB_gill_tissue 0.036455 yes
YFB_stipe_skin YFB_veil 0.017507 yes
YFB_cap_skin YFB_cap_tissue 0.336047 no
YFB_cap_skin YFB_gill_tissue 0.993176 no
YFB_cap_skin YFB_veil 0.865403 no
YFB_cap_tissue YFB_gill_tissue 0.342199 no
YFB_cap_tissue YFB_veil 0.182435 no
YFB_gill_tissue YFB_veil 0.863152 no
Initials DIF_gill_tissue 0.932286 no
Initials YFB_stipe_center 0.697309 no
Initials YFB_stipe_shell 0.673763 no
Initials YFB_stipe_skin 0.670818 no
Initials YFB_cap_skin 0.160907 no
Initials YFB_cap_tissue 0.807607 no
Initials YFB_gill_tissue 0.162096 no
Initials YFB_veil 0.076262 no
Initials Pileal_Stipeal_center 0.927152 no
Initials Pileal_Stipeal_shell 0.475905 no
Initials DIF_stipe_center 0.607845 no
Initials DIF_stipe_shell 0.963050 no
Initials DIF_stipe_skin 0.948641 no
Initials DIF_cap_skin 0.063954 no
Initials DIF_cap_tissue 0.420780 no
Pileal_Stipeal_center DIF_gill_tissue 0.995303 no
Pileal_Stipeal_center YFB_stipe_center 0.802589 no
Pileal_Stipeal_center YFB_stipe_shell 0.555787 no
Pileal_Stipeal_center YFB_stipe_skin 0.551745 no
Pileal_Stipeal_center YFB_cap_skin 0.228817 no
Pileal_Stipeal_center YFB_cap_tissue 0.902642 no
Pileal_Stipeal_center YFB_gill_tissue 0.230028 no
Pileal_Stipeal_center YFB_veil 0.112721 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.599481 no
Pileal_Stipeal_center DIF_stipe_center 0.722973 no
Pileal_Stipeal_center DIF_stipe_shell 0.885362 no
Pileal_Stipeal_center DIF_stipe_skin 0.982888 no
Pileal_Stipeal_center DIF_cap_skin 0.090829 no
Pileal_Stipeal_center DIF_cap_tissue 0.541416 no
Pileal_Stipeal_shell DIF_gill_tissue 0.582971 no
Pileal_Stipeal_shell YFB_stipe_center 0.861839 no
Pileal_Stipeal_shell YFB_stipe_shell 0.162495 no
Pileal_Stipeal_shell YFB_stipe_skin 0.158357 no
Pileal_Stipeal_shell YFB_cap_skin 0.670322 no
Pileal_Stipeal_shell YFB_cap_tissue 0.747457 no
Pileal_Stipeal_shell YFB_gill_tissue 0.673213 no
Pileal_Stipeal_shell YFB_veil 0.469825 no
Pileal_Stipeal_shell DIF_stipe_center 0.926419 no
Pileal_Stipeal_shell DIF_stipe_shell 0.430033 no
Pileal_Stipeal_shell DIF_stipe_skin 0.579258 no
Pileal_Stipeal_shell DIF_cap_skin 0.407913 no
Pileal_Stipeal_shell DIF_cap_tissue 0.969994 no
DIF_stipe_center DIF_gill_tissue 0.710589 no
DIF_stipe_center YFB_stipe_center 0.949084 no
DIF_stipe_center YFB_stipe_shell 0.231107 no
DIF_stipe_center YFB_stipe_skin 0.225481 no
DIF_stipe_center YFB_cap_skin 0.548920 no
DIF_stipe_center YFB_cap_tissue 0.858179 no
DIF_stipe_center YFB_gill_tissue 0.554794 no
DIF_stipe_center YFB_veil 0.351745 no
DIF_stipe_center DIF_stipe_shell 0.550150 no
DIF_stipe_center DIF_stipe_skin 0.707171 no
DIF_stipe_center DIF_cap_skin 0.295620 no
DIF_stipe_center DIF_cap_tissue 0.891802 no
DIF_stipe_shell DIF_gill_tissue 0.888742 no
DIF_stipe_shell YFB_stipe_center 0.636724 no
DIF_stipe_shell YFB_stipe_shell 0.733644 no
DIF_stipe_shell YFB_stipe_skin 0.733033 no
DIF_stipe_shell YFB_cap_skin 0.139559 no
DIF_stipe_shell YFB_cap_tissue 0.749294 no
DIF_stipe_shell YFB_gill_tissue 0.138008 no
DIF_stipe_shell YFB_veil 0.064333 no
DIF_stipe_shell DIF_stipe_skin 0.910194 no
DIF_stipe_shell DIF_cap_skin 0.055182 no
DIF_stipe_shell DIF_cap_tissue 0.369198 no
DIF_stipe_skin DIF_gill_tissue 0.986394 no
DIF_stipe_skin YFB_stipe_center 0.789910 no
DIF_stipe_skin YFB_stipe_shell 0.598702 no
DIF_stipe_skin YFB_stipe_skin 0.595736 no
DIF_stipe_skin YFB_cap_skin 0.228711 no
DIF_stipe_skin YFB_cap_tissue 0.884441 no
DIF_stipe_skin YFB_gill_tissue 0.227928 no
DIF_stipe_skin YFB_veil 0.117172 no
DIF_stipe_skin DIF_cap_skin 0.094657 no
DIF_stipe_skin DIF_cap_tissue 0.527764 no
DIF_cap_skin DIF_gill_tissue 0.091664 no
DIF_cap_skin YFB_stipe_center 0.244478 no
DIF_cap_skin YFB_stipe_shell 0.015242 yes
DIF_cap_skin YFB_stipe_skin 0.015529 yes
DIF_cap_skin YFB_cap_skin 0.812099 no
DIF_cap_skin YFB_cap_tissue 0.157303 no
DIF_cap_skin YFB_gill_tissue 0.813613 no
DIF_cap_skin YFB_veil 0.959650 no
DIF_cap_skin DIF_cap_tissue 0.450877 no
DIF_cap_tissue DIF_gill_tissue 0.527009 no
DIF_cap_tissue YFB_stipe_center 0.818295 no
DIF_cap_tissue YFB_stipe_shell 0.134423 no
DIF_cap_tissue YFB_stipe_skin 0.132135 no
DIF_cap_tissue YFB_cap_skin 0.717812 no
DIF_cap_tissue YFB_cap_tissue 0.697022 no
DIF_cap_tissue YFB_gill_tissue 0.721555 no
DIF_cap_tissue YFB_veil 0.510660 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082990
MFFFRAICALTALTATFAEPIIARQNGNTNQQISDVIDPLAVQTRNNIFLLNTLQANQTASDETVGVVVQQMVAQ
YNDAASGLGAIPVSTGSDTVQPTDIELSRVFGEILQVLGTGLSGLQAQGSVPNFGNMVSQLDPAVAASATALSQV
SPGSLEFAHILLLDVSQFFVAMGVWPETLAVMGF*
Coding >AgabiH97|082990
ATGTTTTTCTTCCGTGCCATTTGCGCTCTTACCGCCCTTACCGCCACATTTGCGGAACCCATCATCGCTAGGCAG
AACGGGAACACCAACCAGCAGATCTCGGATGTCATTGACCCTCTTGCCGTGCAGACACGCAACAACATCTTCTTG
CTTAACACTTTGCAGGCCAACCAGACTGCATCTGACGAGACTGTTGGTGTTGTAGTCCAACAGATGGTCGCGCAA
TACAACGATGCAGCTTCTGGCCTGGGAGCAATTCCTGTCAGCACCGGTTCCGATACAGTGCAACCCACAGACATC
GAATTGAGCCGAGTATTCGGTGAAATACTTCAGGTTCTTGGCACTGGCCTCTCCGGTCTCCAGGCCCAAGGATCC
GTTCCCAACTTTGGCAACATGGTTTCTCAGCTTGATCCTGCTGTCGCTGCCTCTGCCACCGCTCTGTCCCAAGTC
TCACCTGGTAGTCTCGAATTCGCGCATATCTTGTTACTCGACGTAAGCCAATTCTTTGTCGCTATGGGAGTCTGG
CCAGAGACCCTCGCCGTTATGGGTTTCTGA
Transcript >AgabiH97|082990
ATGTTTTTCTTCCGTGCCATTTGCGCTCTTACCGCCCTTACCGCCACATTTGCGGAACCCATCATCGCTAGGCAG
AACGGGAACACCAACCAGCAGATCTCGGATGTCATTGACCCTCTTGCCGTGCAGACACGCAACAACATCTTCTTG
CTTAACACTTTGCAGGCCAACCAGACTGCATCTGACGAGACTGTTGGTGTTGTAGTCCAACAGATGGTCGCGCAA
TACAACGATGCAGCTTCTGGCCTGGGAGCAATTCCTGTCAGCACCGGTTCCGATACAGTGCAACCCACAGACATC
GAATTGAGCCGAGTATTCGGTGAAATACTTCAGGTTCTTGGCACTGGCCTCTCCGGTCTCCAGGCCCAAGGATCC
GTTCCCAACTTTGGCAACATGGTTTCTCAGCTTGATCCTGCTGTCGCTGCCTCTGCCACCGCTCTGTCCCAAGTC
TCACCTGGTAGTCTCGAATTCGCGCATATCTTGTTACTCGACGTAAGCCAATTCTTTGTCGCTATGGGAGTCTGG
CCAGAGACCCTCGCCGTTATGGGTTTCTGA
Gene >AgabiH97|082990
ATGTTTTTCTTCCGTGCCATTTGCGCTCTTACCGCCCTTACCGCCACATTTGCGGAACCCATCATCGCTAGGCAG
AACGGGAACACCAACCAGCAGATCTCGGATGTCATTGACCCTCTTGCCGTGCAGACACGCAACAACATCTTCTTG
CTTAGTAGGTTTGAGTGTGCGGCATAAATAACTGCGGCTAAAAAAAACTTTCAGACACTTTGCAGGCCAACCAGA
CTGCATCTGACGAGACTGTTGGTGTTGTAGTCCAACAGATGGTCGCGCAATACAACGATGCAGCTTCTGGCCTGG
GAGCAATTCCTGTCAGCACCGGTTCCGATACAGTGCAACCCACAGACATCGAATTGAGCCGAGTATTCGGTGAAA
TACTTCAGTACGTCAAAAGCATAATCCCCGGTTTCAGACTTTCAGGCATCTGACTACGGCAAATAGGGTTCTTGG
CACTGGCCTCTCCGGTCTCCAGGCCCAAGGATCCGTTCCCAACTTTGGCAACATGGTTTCTCAGCTTGATCCTGC
TGTCGCTGCCTCTGCCACCGCTCTGTCCCAAGTCTCACCTGGTAGTCTCGAATTCGCGCATATCTTGTGAGCACC
TTTGAACGCAAAAAAGATGGTCATAACTAACGTGAAAACTCAGGTTACTCGACGTAAGCCAATTCTTTGTCGCTA
TGGGAGTCTGGCCAGAGACCCTCGCCGTTATGGGTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail