Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082810
Gene name
Locationscaffold_5:1151438..1152509
Strand+
Gene length (bp)1071
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 1.8E-41 25 234

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P35735|SFK1_YEAST Protein SFK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFK1 PE=1 SV=1 21 222 1.0E-17
sp|Q9Y7U1|SFK1_SCHPO Protein sfk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfk1 PE=3 SV=1 28 233 5.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 74 93 19
3 113 135 22
4 146 168 22
5 181 203 22
6 213 231 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082810
MNRAQSRQSSLRSSNVHPHRHWLYVWVPLFGAIVWFGMLWAMLIVWLALGKPQYVTQEGSIAYISDIGASSLKPL
FIAGCSITAACFFFSLILERFFRHTGRLVAYVRRRERILSIFAIIGSFIGGLGLILLSIFDTGRFTSAHRAFLLV
FIVGVALSAIFTILEFYFLSRDFAELRELRFAYIMKAVIALTLICLAIAFGITLYRDKDAGAVLEWLIAFGFTFY
LLTFFYDLRLSKGIPDGELTSEKLRGGQHSSLP*
Coding >AgabiH97|082810
ATGAATAGGGCCCAGTCCAGACAAAGCAGTCTTCGTTCCTCAAACGTACATCCTCATAGACACTGGCTATATGTC
TGGGTACCTCTTTTCGGAGCAATCGTGTGGTTTGGCATGCTTTGGGCCATGCTTATTGTATGGCTGGCTCTTGGA
AAACCGCAATATGTAACGCAAGAAGGATCTATCGCTTACATATCCGATATCGGTGCCAGTTCTTTGAAACCTTTA
TTCATCGCCGGGTGCTCCATAACGGCTGCATGTTTTTTCTTTTCTCTTATCCTGGAAAGGTTTTTCCGACATACT
GGACGTCTGGTTGCATACGTACGCCGGCGAGAAAGAATACTTAGTATCTTTGCAATAATTGGATCGTTTATTGGT
GGACTTGGACTTATTCTCCTTTCCATTTTTGATACTGGCCGTTTCACGAGTGCGCACCGAGCGTTTCTCTTGGTA
TTCATAGTTGGCGTGGCTTTGAGTGCTATTTTCACCATCCTCGAATTTTACTTTTTATCCAGAGATTTCGCCGAG
CTTCGAGAACTACGATTCGCATACATAATGAAGGCAGTTATTGCTCTAACACTTATCTGTCTGGCTATCGCCTTT
GGGATCACGCTGTATCGTGACAAGGACGCTGGAGCTGTCTTGGAATGGCTCATCGCATTTGGCTTTACGTTTTAC
CTGTTGACTTTCTTCTATGACCTACGCCTTTCGAAGGGGATCCCCGATGGAGAACTTACAAGCGAAAAATTACGG
GGGGGACAACATTCCTCTTTACCTTAG
Transcript >AgabiH97|082810
ATGAATAGGGCCCAGTCCAGACAAAGCAGTCTTCGTTCCTCAAACGTACATCCTCATAGACACTGGCTATATGTC
TGGGTACCTCTTTTCGGAGCAATCGTGTGGTTTGGCATGCTTTGGGCCATGCTTATTGTATGGCTGGCTCTTGGA
AAACCGCAATATGTAACGCAAGAAGGATCTATCGCTTACATATCCGATATCGGTGCCAGTTCTTTGAAACCTTTA
TTCATCGCCGGGTGCTCCATAACGGCTGCATGTTTTTTCTTTTCTCTTATCCTGGAAAGGTTTTTCCGACATACT
GGACGTCTGGTTGCATACGTACGCCGGCGAGAAAGAATACTTAGTATCTTTGCAATAATTGGATCGTTTATTGGT
GGACTTGGACTTATTCTCCTTTCCATTTTTGATACTGGCCGTTTCACGAGTGCGCACCGAGCGTTTCTCTTGGTA
TTCATAGTTGGCGTGGCTTTGAGTGCTATTTTCACCATCCTCGAATTTTACTTTTTATCCAGAGATTTCGCCGAG
CTTCGAGAACTACGATTCGCATACATAATGAAGGCAGTTATTGCTCTAACACTTATCTGTCTGGCTATCGCCTTT
GGGATCACGCTGTATCGTGACAAGGACGCTGGAGCTGTCTTGGAATGGCTCATCGCATTTGGCTTTACGTTTTAC
CTGTTGACTTTCTTCTATGACCTACGCCTTTCGAAGGGGATCCCCGATGGAGAACTTACAAGCGAAAAATTACGG
GGGGGACAACATTCCTCTTTACCTTAG
Gene >AgabiH97|082810
ATGAATAGGTTTAACATGTTTGCCGCGTTTTAGACGAAATGTATTCACCTCCTACATGAACCCTTTCGCTTCCAG
GGCCCAGTCCAGACAAAGCAGTCTTCGTTCCTCAAACGTACATCCTCATAGACACTGGCTATATGTCTGGGTACC
TCTTTTCGGAGCAATCGTGTGGTTTGGTTCGTTAACCAGTCTTTCGGAGTCTCAATACCAATAACATGAATTTCG
CATGAAGGCATGCTTTGGGCCATGCTTATTGTATGGCTGGCTCTTGGAAAACCGCAATATGTAACGCAAGAAGGA
TCTATCGCTTACATATCCGATATCGGTGCCAGTTCTTTGAAACCTTTATTCATCGCCGGGTGCTCCATAACGGCT
GCATGTTTTTTCTTTTCTCTTATCCTGGAAAGGTTTTTCCGACATACTGGACGGTGATTAATTTCCTGTCTGTCG
TCTGTGGCCTCTTATTCACTCTAAAAAATATCGCACAGTCTGGTTGCATACGTACGCCGGCGAGAAAGAATACTT
AGTATCTTTGCAATAATTGGATCGTTTATTGGTGGACTTGGACTTATTCTCCTTTCCATTTTTGATACTGGCCGT
TTCACGAGTGCGCACCGAGCGTTTCTCTTGGTATTCATAGTTGGCGTGGCTTTGAGTGCTATTTTCACCATCCTC
GAAGTGCGTTAATACAATCAATTGTGTCCGGGATACATTTTTTGCTGACCTTTTCTAGTTTTACTTTTTATCCAG
AGATTTCGCCGAGCTTCGAGAACTACGATTCGCATACATAATGAAGGCAGTTATTGCTCTAACACTTATCTGTCT
GGCTATCGCCTTTGGGATCACGCTGTATCGTGACAAGGACGCTGGAGGTAACACTTTTCATCTTTTCCCTTCTCA
TCGGTTTATTGACAAATCATCATCGTAGCTGTCTTGGAATGGCTCATCGCATTTGGCTTTACGTTTTACCTGTTG
ACTTTCTTCTATGACCTACGCCTTTCGAAGGGGATCCCCGATGGAGAACTTACAAGCGAAAAATTACGGGGGGGA
CAACATTCCTCTTTACCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail