Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082770
Gene name
Locationscaffold_5:1138024..1140532
Strand-
Gene length (bp)2508
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 6.3E-70 88 311
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 6.4E-33 314 496

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 91 511 4.0E-144
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 88 524 2.0E-141
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 88 512 3.0E-140
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 88 524 3.0E-140
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 88 520 8.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 91 511 4.0E-144
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 88 524 2.0E-141
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 88 512 3.0E-140
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 88 524 3.0E-140
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 88 520 8.0E-140
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 88 524 1.0E-139
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 96 524 2.0E-137
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 91 512 2.0E-137
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 96 524 3.0E-137
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 88 532 4.0E-137
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 96 512 6.0E-137
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 96 512 1.0E-136
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 88 524 1.0E-136
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 91 512 5.0E-136
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 91 512 9.0E-136
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 59 512 1.0E-135
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 82 512 1.0E-135
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 88 509 4.0E-134
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 88 509 4.0E-134
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 84 511 2.0E-130
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 96 504 2.0E-125
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 92 500 1.0E-112
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 95 511 5.0E-112
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 83 493 5.0E-96
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 51 498 7.0E-96
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 94 498 3.0E-75
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 63 504 1.0E-43
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 94 500 1.0E-41
sp|Q12471|6P22_YEAST 6-phosphofructo-2-kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK27 PE=1 SV=1 86 276 2.0E-11
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 314 500 3.0E-09
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 314 469 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006000 fructose metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044281 small molecule metabolic process No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008443 phosphofructokinase activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0019318 hexose metabolic process No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005996 monosaccharide metabolic process No
GO:0016740 transferase activity No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019200 carbohydrate kinase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082770
MADPNASPTVPTLRITESLTRVAGVLQDMQNRRGELQAMSPGLPPAAFGAGSPMLKQFDESTVTSRKGSQAATPP
VAVKGIGGKVAKPDYSDNKIVLAMVGLPARGKSYLSNKLQIYLKWLEYDVEVFNVGQLRRTRARQMAQQSGVKEE
HTASWFSHDNQSANESREKLAQDSLEMLIAWLKLGGNVGIHDATNSTRERRAWIEQRVKQEKGLDLIFLESVCDD
PAIIASNVALKVTSGDPDYKDTSPEEAKRDFLRRIEAYQKVYETITEDHLSYLRIVNVGNNVTVSNIHGYLASRI
AFYLMNLHLKPRSIYLSRHGESQFNVEGKIGGDSLLSPRGMQYADALPELITDNIGNAQLTVWTSTLRRTIQTGS
KLPYPKLTWKSLDELDAGVCDAMTYEEIERAYPDDFANRDEDKFNYRYRGGESYRDVVVRLEPVIMELERQENVL
VIGHQAILRCLYAYFHNLPQADLPYIKIPLHTVIKLTPKAYGCDEERYALPIQAVDTHRPKPGTPSLNVQPTVAR
KYFTEVDATKGGKV*
Coding >AgabiH97|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTACCACCTGCTGCTTTTGGTGCT
GGAAGTCCTATGCTTAAGCAATTCGATGAATCGACTGTTACAAGTCGGAAAGGATCTCAGGCTGCTACACCACCA
GTGGCGGTCAAGGGTATTGGAGGGAAAGTTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTT
GGATTACCTGCTAGAGGTAAATCTTACCTCAGTAATAAACTACAGATATACCTCAAGTGGCTCGAATATGATGTC
GAGGTTTTTAATGTCGGCCAACTGCGACGGACGAGGGCTCGGCAAATGGCACAGCAATCGGGTGTCAAGGAGGAA
CATACAGCATCTTGGTTTAGTCACGATAATCAGAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTG
GAGATGCTAATTGCCTGGCTAAAGTTGGGTGGAAATGTCGGCATTCATGATGCTACGAATAGTACTCGTGAACGC
AGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTCGAATCAGTTTGTGACGAT
CCGGCAATTATTGCATCCAATGTTGCTCTCAAAGTAACTTCGGGTGATCCTGACTACAAGGATACTTCACCCGAG
GAGGCGAAACGAGATTTCTTACGGAGAATCGAAGCATATCAGAAGGTTTATGAAACCATCACGGAAGATCATTTA
TCTTATTTGCGAATTGTCAATGTTGGGAACAACGTTACGGTCTCGAATATTCATGGATACCTAGCCAGTCGGATT
GCGTTCTATCTTATGAATTTACACCTGAAGCCCCGGAGTATTTATCTTTCGAGACATGGAGAAAGCCAGTTTAAT
GTAGAGGGTAAAATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTG
ATCACGGATAATATTGGTAATGCCCAGTTGACGGTATGGACATCGACATTGCGACGCACTATTCAGACGGGATCA
AAGTTACCCTATCCGAAATTAACATGGAAATCTTTGGATGAGTTAGACGCAGGTGTTTGCGATGCAATGACTTAT
GAGGAAATTGAGCGAGCTTATCCAGACGATTTCGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGA
GGAGAATCTTATCGGGATGTCGTTGTGCGGTTGGAGCCAGTTATCATGGAACTGGAACGTCAGGAGAATGTTCTG
GTCATAGGTCACCAAGCGATTTTGCGTTGTCTCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCTACCTTAT
ATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCATATGGTTGTGACGAGGAGCGATATGCGCTG
CCGATTCAGGCTGTAGACACTCATCGACCAAAACCGGGGACGCCGTCTCTGAATGTGCAGCCTACAGTAGCTCGA
AAATATTTTACTGAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG
Transcript >AgabiH97|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTACCACCTGCTGCTTTTGGTGCT
GGAAGTCCTATGCTTAAGCAATTCGATGAATCGACTGTTACAAGTCGGAAAGGATCTCAGGCTGCTACACCACCA
GTGGCGGTCAAGGGTATTGGAGGGAAAGTTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTT
GGATTACCTGCTAGAGGTAAATCTTACCTCAGTAATAAACTACAGATATACCTCAAGTGGCTCGAATATGATGTC
GAGGTTTTTAATGTCGGCCAACTGCGACGGACGAGGGCTCGGCAAATGGCACAGCAATCGGGTGTCAAGGAGGAA
CATACAGCATCTTGGTTTAGTCACGATAATCAGAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTG
GAGATGCTAATTGCCTGGCTAAAGTTGGGTGGAAATGTCGGCATTCATGATGCTACGAATAGTACTCGTGAACGC
AGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTCGAATCAGTTTGTGACGAT
CCGGCAATTATTGCATCCAATGTTGCTCTCAAAGTAACTTCGGGTGATCCTGACTACAAGGATACTTCACCCGAG
GAGGCGAAACGAGATTTCTTACGGAGAATCGAAGCATATCAGAAGGTTTATGAAACCATCACGGAAGATCATTTA
TCTTATTTGCGAATTGTCAATGTTGGGAACAACGTTACGGTCTCGAATATTCATGGATACCTAGCCAGTCGGATT
GCGTTCTATCTTATGAATTTACACCTGAAGCCCCGGAGTATTTATCTTTCGAGACATGGAGAAAGCCAGTTTAAT
GTAGAGGGTAAAATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTG
ATCACGGATAATATTGGTAATGCCCAGTTGACGGTATGGACATCGACATTGCGACGCACTATTCAGACGGGATCA
AAGTTACCCTATCCGAAATTAACATGGAAATCTTTGGATGAGTTAGACGCAGGTGTTTGCGATGCAATGACTTAT
GAGGAAATTGAGCGAGCTTATCCAGACGATTTCGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGA
GGAGAATCTTATCGGGATGTCGTTGTGCGGTTGGAGCCAGTTATCATGGAACTGGAACGTCAGGAGAATGTTCTG
GTCATAGGTCACCAAGCGATTTTGCGTTGTCTCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCTACCTTAT
ATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCATATGGTTGTGACGAGGAGCGATATGCGCTG
CCGATTCAGGCTGTAGACACTCATCGACCAAAACCGGGGACGCCGTCTCTGAATGTGCAGCCTACAGTAGCTCGA
AAATATTTTACTGAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG
Gene >AgabiH97|082770
ATGGCTGATCCTAACGCAAGCCCCACGGTCCCCACTCTTAGGATCACTGAAAGTTTGACCCGCGTTGCTGGTGTA
CTGCAAGACATGCAGAATCGTAGAGGGGAATTGCAAGCCATGTCTCCGGGGCTACCACCTGCTGCTTTTGGTGCT
GGAAGTCCTATGTAAGTTTCGACACTTTTTGCTCCTTTACTTGCTGACTATTTGTATGCTTTAGGCTTAAGCAAT
TCGATGAATCGACTGTTACAAGTCGGAAAGGATCTCAGGCTGCTACACCACCAGTGGCGGTCAAGGGTATTGGAG
GGAAAGGTGGGGAGGCTTCTTCTTCTTCTCTGTGGTGTGATCAAGGTTCTAATGCTTCAGATTTGTGTTATCGAC
AGTTGCTAAGCCTGATTACTCGGATAACAAGATCGTGTTAGCAATGGTATGTCGAGTGTACTAGGCGATCTTCAA
ATCTGGAGGAAGACGTGTGTATAATGCGATTTTTTATAGGTTGGATTACCTGCTAGAGGTAAATCTTACCTCAGT
AATAAACTACAGATATACCTCAAGGTGATTGGACGCCTTCATCATGTCTGATAAGTGTCGGGGGCTGATTCTTGA
TATTAGTGGCTCGAATATGATGTCGAGGTATGTGTTGATCCTTCGCGTTTGCTAGAACCTGGTCGTTATCTCTCG
AAAGGTTTTTAATGTCGGCCAACTGCGACGGACGAGGGCTCGGCAAATGGCACAGCAGTACGTAGTTTTTCAGTT
TCTAGAATTGCGCTAATTCCGTTGGGCTTGTTTAGATCGGGTGTCAAGGAGGAACATACAGCATCTTGGTTTAGT
CACGATAATCAGAGTGCCAATGAGTCCCGAGAAAAATTGGCGCAAGATAGCTTGGAGATGCTAATTGCCTGGCTA
AAGTTGGGTGGAAATGTCGGCATTCATGGTGCGTTTCTCGCTTGACGGCCGATGACGCTATAACTAATATTACAG
CTTACAGATGCTACGAATAGTACTCGTGAACGCAGGTGTGTCATTCACCTTTCCCTGTCTAACACTCAAAATTCA
TTGTCATGCAGGGCATGGATCGAGCAAAGAGTGAAACAAGAAAAAGGTCTTGATCTCATATTCCTCGAATCAGTT
TGTGACGATCCGGCAATTATTGCATCCAATGTTGCTCTCAAAGTAACTTCGGGTGATCCTGACTACAAGGATACT
TCACCCGAGGAGGCGAAACGAGATTTCTTACGGAGAATCGAAGCATATCAGAAGGTTTATGAAACCATCACGGAA
GATCATTTATCTTATTTGCGAATTGTCAATGTTGGGAACAACGTTACGGTCTCGAATATTCATGGATACCTAGCC
AGTCGGATTGCGTTCTATCTTATGAATTTACACCTGAAGCCCCGGAGTATTTATCTTTCGAGAGTGAGTGGTTGT
TTATGAGATATAATATTCTAACTGGGGTTTCTCTTTTGTTCAGCATGGAGAAAGCCAGTTTAATGTAGAGGGTAA
AATTGGAGGTGATTCCTTGCTTTCACCGCGAGGCATGCAATATGCAGATGCGTTGCCTGAGTTGATCACGGATAA
TATTGGTAATGCCCAGTTGACGGTAAGCTTTGCTTATCTTCGTTCGTAACCTGGGCCTGCAAATGTTTGTGCTGC
AGGTATGGACATCGACATTGCGACGCACTATTCAGACGGGATCAAAGTTACCCTATCCGAAATTAACATGGAAAT
CTTTGGATGAGTTAGACGCAGGTGCGTGTTGGGTCGCTTACTTGAATTAATTGTAATATTTCCAAACAGGTGTTT
GCGATGCAATGACTTATGAGGTGAGAAAATCCACTTGTTTGAAGGAGCATATTAACAGAAACTTGCGGCGCAGGA
AATTGAGGTAGAGAATCCATGTTTCATTTACATGCTTACCACATGATGATGGACTTGTCAAGCGAGCTTATCCAG
ACGATTTCGCAAATCGGGATGAAGACAAATTCAACTACCGGTATCGAGGAGGAGAATCTTATCGGGATGTCGTTG
TGCGGTTGGAGCCAGTTATCATGGAACTGGAACGTCAGGAGAATGTTCTGGTCATAGGTCACCAAGTGAGTTTTA
GAGCTTCATTGAACGCGTGTGGCTTAACTCATATCACATCACTTGAGGCGATTTTGCGTTGTCTGTGAGTCTGTT
AATGGATGTGCTGTTGGATTGATTATATACCACCGCTAGCTACGCCTATTTCCACAACTTGCCTCAAGCGGATCT
ACCTTATATCAAGATACCATTGCACACTGTCATCAAATTGACTCCCAAGGCATATGGTTGTGACGAGGAGCGGTG
AGAGATTCCAATGCGATTTTGAGAATTGTTTCCTTACATGGAAAAACTTGCAGATATGCGCTGCCGATTCAGGCT
GTAGACACTCATCGACCAAAACCGGGGACGCCGTCTCTGAATGTGCAGCCTACAGTAGCTCGAAAATATTTTACT
GAGGTTGACGCGACCAAAGGTGGCAAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail