Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082620
Gene name
Locationscaffold_5:1113275..1113969
Strand-
Gene length (bp)694
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 712.86 402.71 1023.00
Initials Initials knots 431.55 256.53 606.57
Pileal_Stipeal_center Stage I stipe center 448.46 263.45 633.46
Pileal_Stipeal_shell Stage I stipe shell 356.48 213.67 499.30
DIF_stipe_center Stage II stipe center 427.64 254.56 600.71
DIF_stipe_shell Stage II stipe shell 413.50 246.31 580.70
DIF_stipe_skin Stage II stipe skin 415.15 247.31 582.99
DIF_cap_skin Stage II cap skin 376.80 224.85 528.76
DIF_cap_tissue Stage II cap tissue 356.36 213.49 499.22
DIF_gill_tissue Stage II gill tissue 404.82 241.36 568.28
YFB_stipe_center Young fruiting body stipe center 520.18 306.05 734.31
YFB_stipe_shell Young fruiting body stipe shell 485.03 287.12 682.94
YFB_stipe_skin Young fruiting body stipe skin 458.75 271.31 646.19
YFB_cap_skin Young fruiting body cap skin 447.39 265.18 629.60
YFB_cap_tissue Young fruiting body cap tissue 429.44 255.22 603.66
YFB_gill_tissue Young fruiting body gill tissue 402.62 239.94 565.30
YFB_veil Young fruiting body veil 420.73 250.01 591.45

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.040279 yes
Casing YFB_stipe_center 0.349136 no
Casing YFB_stipe_shell 0.204693 no
Casing YFB_stipe_skin 0.129541 no
Casing YFB_cap_skin 0.105377 no
Casing YFB_cap_tissue 0.075734 no
Casing YFB_gill_tissue 0.033211 yes
Casing YFB_veil 0.062420 no
Casing Initials 0.080353 no
Casing Pileal_Stipeal_center 0.116263 no
Casing Pileal_Stipeal_shell 0.010728 yes
Casing DIF_stipe_center 0.073043 no
Casing DIF_stipe_shell 0.049046 yes
Casing DIF_stipe_skin 0.053965 no
Casing DIF_cap_skin 0.015529 yes
Casing DIF_cap_tissue 0.009446 yes
DIF_gill_tissue YFB_stipe_center 0.473262 no
DIF_gill_tissue YFB_stipe_shell 0.635876 no
DIF_gill_tissue YFB_stipe_skin 0.773657 no
DIF_gill_tissue YFB_cap_skin 0.829317 no
DIF_gill_tissue YFB_cap_tissue 0.908349 no
DIF_gill_tissue YFB_gill_tissue 0.991727 no
DIF_gill_tissue YFB_veil 0.942584 no
YFB_stipe_center YFB_stipe_shell 0.891292 no
YFB_stipe_center YFB_stipe_skin 0.775760 no
YFB_stipe_center YFB_cap_skin 0.720417 no
YFB_stipe_center YFB_cap_tissue 0.619112 no
YFB_stipe_center YFB_gill_tissue 0.460782 no
YFB_stipe_center YFB_veil 0.575097 no
YFB_stipe_shell YFB_stipe_skin 0.911483 no
YFB_stipe_shell YFB_cap_skin 0.866425 no
YFB_stipe_shell YFB_cap_tissue 0.778468 no
YFB_stipe_shell YFB_gill_tissue 0.622063 no
YFB_stipe_shell YFB_veil 0.735060 no
YFB_stipe_skin YFB_cap_skin 0.965068 no
YFB_stipe_skin YFB_cap_tissue 0.894638 no
YFB_stipe_skin YFB_gill_tissue 0.758684 no
YFB_stipe_skin YFB_veil 0.856413 no
YFB_cap_skin YFB_cap_tissue 0.939352 no
YFB_cap_skin YFB_gill_tissue 0.817817 no
YFB_cap_skin YFB_veil 0.903836 no
YFB_cap_tissue YFB_gill_tissue 0.899219 no
YFB_cap_tissue YFB_veil 0.969739 no
YFB_gill_tissue YFB_veil 0.934109 no
Initials DIF_gill_tissue 0.899351 no
Initials YFB_stipe_center 0.632003 no
Initials YFB_stipe_shell 0.792772 no
Initials YFB_stipe_skin 0.903942 no
Initials YFB_cap_skin 0.948117 no
Initials YFB_cap_tissue 0.992484 no
Initials YFB_gill_tissue 0.890311 no
Initials YFB_veil 0.962482 no
Initials Pileal_Stipeal_center 0.944016 no
Initials Pileal_Stipeal_shell 0.613280 no
Initials DIF_stipe_center 0.986307 no
Initials DIF_stipe_shell 0.937842 no
Initials DIF_stipe_skin 0.942888 no
Initials DIF_cap_skin 0.748725 no
Initials DIF_cap_tissue 0.606272 no
Pileal_Stipeal_center DIF_gill_tissue 0.825715 no
Pileal_Stipeal_center YFB_stipe_center 0.728004 no
Pileal_Stipeal_center YFB_stipe_shell 0.873446 no
Pileal_Stipeal_center YFB_stipe_skin 0.967624 no
Pileal_Stipeal_center YFB_cap_skin 0.996297 no
Pileal_Stipeal_center YFB_cap_tissue 0.935269 no
Pileal_Stipeal_center YFB_gill_tissue 0.815588 no
Pileal_Stipeal_center YFB_veil 0.900295 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.521563 no
Pileal_Stipeal_center DIF_stipe_center 0.929094 no
Pileal_Stipeal_center DIF_stipe_shell 0.870022 no
Pileal_Stipeal_center DIF_stipe_skin 0.877630 no
Pileal_Stipeal_center DIF_cap_skin 0.661817 no
Pileal_Stipeal_center DIF_cap_tissue 0.517087 no
Pileal_Stipeal_shell DIF_gill_tissue 0.767338 no
Pileal_Stipeal_shell YFB_stipe_center 0.201633 no
Pileal_Stipeal_shell YFB_stipe_shell 0.323787 no
Pileal_Stipeal_shell YFB_stipe_skin 0.454351 no
Pileal_Stipeal_shell YFB_cap_skin 0.519530 no
Pileal_Stipeal_shell YFB_cap_tissue 0.621032 no
Pileal_Stipeal_shell YFB_gill_tissue 0.776241 no
Pileal_Stipeal_shell YFB_veil 0.679504 no
Pileal_Stipeal_shell DIF_stipe_center 0.636432 no
Pileal_Stipeal_shell DIF_stipe_shell 0.718179 no
Pileal_Stipeal_shell DIF_stipe_skin 0.706926 no
Pileal_Stipeal_shell DIF_cap_skin 0.915128 no
Pileal_Stipeal_shell DIF_cap_tissue 0.999379 no
DIF_stipe_center DIF_gill_tissue 0.915128 no
DIF_stipe_center YFB_stipe_center 0.607221 no
DIF_stipe_center YFB_stipe_shell 0.771301 no
DIF_stipe_center YFB_stipe_skin 0.885893 no
DIF_stipe_center YFB_cap_skin 0.931940 no
DIF_stipe_center YFB_cap_tissue 0.993348 no
DIF_stipe_center YFB_gill_tissue 0.905706 no
DIF_stipe_center YFB_veil 0.976502 no
DIF_stipe_center DIF_stipe_shell 0.952460 no
DIF_stipe_center DIF_stipe_skin 0.956475 no
DIF_stipe_center DIF_cap_skin 0.769119 no
DIF_stipe_center DIF_cap_tissue 0.627679 no
DIF_stipe_shell DIF_gill_tissue 0.968647 no
DIF_stipe_shell YFB_stipe_center 0.527881 no
DIF_stipe_shell YFB_stipe_shell 0.693455 no
DIF_stipe_shell YFB_stipe_skin 0.819833 no
DIF_stipe_shell YFB_cap_skin 0.871469 no
DIF_stipe_shell YFB_cap_tissue 0.943748 no
DIF_stipe_shell YFB_gill_tissue 0.960790 no
DIF_stipe_shell YFB_veil 0.974310 no
DIF_stipe_shell DIF_stipe_skin 0.993155 no
DIF_stipe_shell DIF_cap_skin 0.844325 no
DIF_stipe_shell DIF_cap_tissue 0.718223 no
DIF_stipe_skin DIF_gill_tissue 0.963939 no
DIF_stipe_skin YFB_stipe_center 0.534262 no
DIF_stipe_skin YFB_stipe_shell 0.698858 no
DIF_stipe_skin YFB_stipe_skin 0.825173 no
DIF_stipe_skin YFB_cap_skin 0.877773 no
DIF_stipe_skin YFB_cap_tissue 0.950766 no
DIF_stipe_skin YFB_gill_tissue 0.956097 no
DIF_stipe_skin YFB_veil 0.980338 no
DIF_stipe_skin DIF_cap_skin 0.833689 no
DIF_stipe_skin DIF_cap_tissue 0.702806 no
DIF_cap_skin DIF_gill_tissue 0.884202 no
DIF_cap_skin YFB_stipe_center 0.313257 no
DIF_cap_skin YFB_stipe_shell 0.458124 no
DIF_cap_skin YFB_stipe_skin 0.599644 no
DIF_cap_skin YFB_cap_skin 0.665615 no
DIF_cap_skin YFB_cap_tissue 0.762045 no
DIF_cap_skin YFB_gill_tissue 0.896151 no
DIF_cap_skin YFB_veil 0.809878 no
DIF_cap_skin DIF_cap_tissue 0.913475 no
DIF_cap_tissue DIF_gill_tissue 0.766987 no
DIF_cap_tissue YFB_stipe_center 0.198419 no
DIF_cap_tissue YFB_stipe_shell 0.321182 no
DIF_cap_tissue YFB_stipe_skin 0.453646 no
DIF_cap_tissue YFB_cap_skin 0.517741 no
DIF_cap_tissue YFB_cap_tissue 0.621431 no
DIF_cap_tissue YFB_gill_tissue 0.776293 no
DIF_cap_tissue YFB_veil 0.678405 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082620
MIVFRLFFSLCFSFLVYAQTQTIVDEAGQSVVVVGTLDPAGLPVTQTIETLPAGGVVDPNTNTLTTTADPAAAAT
TTPTTTVTPPGQGPVDEPAATTGTPFGPTPFTYTTEIDGVTTAVLDTFSPTDIATTPFTPTASGTVWEYSDWLSS
FGGSQATAAAAAGSRNAGHRLGATDAVVMMMTTCLFSVFHLL*
Coding >AgabiH97|082620
ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT
GAGGCAGGTCAATCCGTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATTGAAACC
CTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAACACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACG
ACTACCCCTACAACTACAGTAACACCTCCTGGACAAGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCT
TTCGGTCCTACTCCCTTCACTTACACGACTGAAATCGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCT
ACTGATATCGCAACCACCCCGTTTACTCCAACTGCAAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGT
TTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGCTGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGAC
GCTGTTGTGATGATGATGACGACCTGCTTGTTTTCAGTTTTCCACTTGCTGTGA
Transcript >AgabiH97|082620
ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT
GAGGCAGGTCAATCCGTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATTGAAACC
CTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAACACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACG
ACTACCCCTACAACTACAGTAACACCTCCTGGACAAGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCT
TTCGGTCCTACTCCCTTCACTTACACGACTGAAATCGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCT
ACTGATATCGCAACCACCCCGTTTACTCCAACTGCAAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGT
TTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGCTGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGAC
GCTGTTGTGATGATGATGACGACCTGCTTGTTTTCAGTTTTCCACTTGCTGTGA
Gene >AgabiH97|082620
ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT
GAGTACGATCCGTCTTTGTAATAAAGTTGTCTTTCTCCTTTTTCATGCTCTTTTCCATCCAGGGCAGGTCAATCC
GTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATGTAAATAGTATTTTTCGTCCTC
CTAAGTGCCACTATTGACTCGATTCGATGCCAGTGAAACCCTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAA
CACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACGACTACCCCTACAACTACAGTAACACCTCCTGGACA
AGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCTTTCGGTCCTACTCCCTTCACTTACACGACTGAAAT
CGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCTACTGATATCGCAACCACCCCGTTTACTCCAACTGC
AAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGTTTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGC
TGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGACGCTGTTGTGATGATGATGACGACCTGCTTGTTTTC
AGTTTTCCACTTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail