© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|082620 |
| Gene name | |
| Location | scaffold_5:1113275..1113969 |
| Strand | - |
| Gene length (bp) | 694 |
| Transcript length (bp) | 579 |
| Coding sequence length (bp) | 579 |
| Protein length (aa) | 193 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 19 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 712.86 | 402.71 | 1023.00 |
| Initials | Initials knots | 431.55 | 256.53 | 606.57 |
| Pileal_Stipeal_center | Stage I stipe center | 448.46 | 263.45 | 633.46 |
| Pileal_Stipeal_shell | Stage I stipe shell | 356.48 | 213.67 | 499.30 |
| DIF_stipe_center | Stage II stipe center | 427.64 | 254.56 | 600.71 |
| DIF_stipe_shell | Stage II stipe shell | 413.50 | 246.31 | 580.70 |
| DIF_stipe_skin | Stage II stipe skin | 415.15 | 247.31 | 582.99 |
| DIF_cap_skin | Stage II cap skin | 376.80 | 224.85 | 528.76 |
| DIF_cap_tissue | Stage II cap tissue | 356.36 | 213.49 | 499.22 |
| DIF_gill_tissue | Stage II gill tissue | 404.82 | 241.36 | 568.28 |
| YFB_stipe_center | Young fruiting body stipe center | 520.18 | 306.05 | 734.31 |
| YFB_stipe_shell | Young fruiting body stipe shell | 485.03 | 287.12 | 682.94 |
| YFB_stipe_skin | Young fruiting body stipe skin | 458.75 | 271.31 | 646.19 |
| YFB_cap_skin | Young fruiting body cap skin | 447.39 | 265.18 | 629.60 |
| YFB_cap_tissue | Young fruiting body cap tissue | 429.44 | 255.22 | 603.66 |
| YFB_gill_tissue | Young fruiting body gill tissue | 402.62 | 239.94 | 565.30 |
| YFB_veil | Young fruiting body veil | 420.73 | 250.01 | 591.45 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.040279 | yes |
| Casing | YFB_stipe_center | 0.349136 | no |
| Casing | YFB_stipe_shell | 0.204693 | no |
| Casing | YFB_stipe_skin | 0.129541 | no |
| Casing | YFB_cap_skin | 0.105377 | no |
| Casing | YFB_cap_tissue | 0.075734 | no |
| Casing | YFB_gill_tissue | 0.033211 | yes |
| Casing | YFB_veil | 0.062420 | no |
| Casing | Initials | 0.080353 | no |
| Casing | Pileal_Stipeal_center | 0.116263 | no |
| Casing | Pileal_Stipeal_shell | 0.010728 | yes |
| Casing | DIF_stipe_center | 0.073043 | no |
| Casing | DIF_stipe_shell | 0.049046 | yes |
| Casing | DIF_stipe_skin | 0.053965 | no |
| Casing | DIF_cap_skin | 0.015529 | yes |
| Casing | DIF_cap_tissue | 0.009446 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.473262 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.635876 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.773657 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.829317 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.908349 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.991727 | no |
| DIF_gill_tissue | YFB_veil | 0.942584 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.891292 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.775760 | no |
| YFB_stipe_center | YFB_cap_skin | 0.720417 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.619112 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.460782 | no |
| YFB_stipe_center | YFB_veil | 0.575097 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.911483 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.866425 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.778468 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.622063 | no |
| YFB_stipe_shell | YFB_veil | 0.735060 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.965068 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.894638 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.758684 | no |
| YFB_stipe_skin | YFB_veil | 0.856413 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.939352 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.817817 | no |
| YFB_cap_skin | YFB_veil | 0.903836 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.899219 | no |
| YFB_cap_tissue | YFB_veil | 0.969739 | no |
| YFB_gill_tissue | YFB_veil | 0.934109 | no |
| Initials | DIF_gill_tissue | 0.899351 | no |
| Initials | YFB_stipe_center | 0.632003 | no |
| Initials | YFB_stipe_shell | 0.792772 | no |
| Initials | YFB_stipe_skin | 0.903942 | no |
| Initials | YFB_cap_skin | 0.948117 | no |
| Initials | YFB_cap_tissue | 0.992484 | no |
| Initials | YFB_gill_tissue | 0.890311 | no |
| Initials | YFB_veil | 0.962482 | no |
| Initials | Pileal_Stipeal_center | 0.944016 | no |
| Initials | Pileal_Stipeal_shell | 0.613280 | no |
| Initials | DIF_stipe_center | 0.986307 | no |
| Initials | DIF_stipe_shell | 0.937842 | no |
| Initials | DIF_stipe_skin | 0.942888 | no |
| Initials | DIF_cap_skin | 0.748725 | no |
| Initials | DIF_cap_tissue | 0.606272 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.825715 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.728004 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.873446 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.967624 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.996297 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.935269 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.815588 | no |
| Pileal_Stipeal_center | YFB_veil | 0.900295 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.521563 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.929094 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.870022 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.877630 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.661817 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.517087 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.767338 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.201633 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.323787 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.454351 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.519530 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.621032 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.776241 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.679504 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.636432 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.718179 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.706926 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.915128 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.999379 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.915128 | no |
| DIF_stipe_center | YFB_stipe_center | 0.607221 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.771301 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.885893 | no |
| DIF_stipe_center | YFB_cap_skin | 0.931940 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.993348 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.905706 | no |
| DIF_stipe_center | YFB_veil | 0.976502 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.952460 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.956475 | no |
| DIF_stipe_center | DIF_cap_skin | 0.769119 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.627679 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.968647 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.527881 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.693455 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.819833 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.871469 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.943748 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.960790 | no |
| DIF_stipe_shell | YFB_veil | 0.974310 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.993155 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.844325 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.718223 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.963939 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.534262 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.698858 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.825173 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.877773 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.950766 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.956097 | no |
| DIF_stipe_skin | YFB_veil | 0.980338 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.833689 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.702806 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.884202 | no |
| DIF_cap_skin | YFB_stipe_center | 0.313257 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.458124 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.599644 | no |
| DIF_cap_skin | YFB_cap_skin | 0.665615 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.762045 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.896151 | no |
| DIF_cap_skin | YFB_veil | 0.809878 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.913475 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.766987 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.198419 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.321182 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.453646 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.517741 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.621431 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.776293 | no |
| DIF_cap_tissue | YFB_veil | 0.678405 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|082620 MIVFRLFFSLCFSFLVYAQTQTIVDEAGQSVVVVGTLDPAGLPVTQTIETLPAGGVVDPNTNTLTTTADPAAAAT TTPTTTVTPPGQGPVDEPAATTGTPFGPTPFTYTTEIDGVTTAVLDTFSPTDIATTPFTPTASGTVWEYSDWLSS FGGSQATAAAAAGSRNAGHRLGATDAVVMMMTTCLFSVFHLL* |
| Coding | >AgabiH97|082620 ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT GAGGCAGGTCAATCCGTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATTGAAACC CTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAACACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACG ACTACCCCTACAACTACAGTAACACCTCCTGGACAAGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCT TTCGGTCCTACTCCCTTCACTTACACGACTGAAATCGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCT ACTGATATCGCAACCACCCCGTTTACTCCAACTGCAAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGT TTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGCTGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGAC GCTGTTGTGATGATGATGACGACCTGCTTGTTTTCAGTTTTCCACTTGCTGTGA |
| Transcript | >AgabiH97|082620 ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT GAGGCAGGTCAATCCGTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATTGAAACC CTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAACACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACG ACTACCCCTACAACTACAGTAACACCTCCTGGACAAGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCT TTCGGTCCTACTCCCTTCACTTACACGACTGAAATCGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCT ACTGATATCGCAACCACCCCGTTTACTCCAACTGCAAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGT TTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGCTGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGAC GCTGTTGTGATGATGATGACGACCTGCTTGTTTTCAGTTTTCCACTTGCTGTGA |
| Gene | >AgabiH97|082620 ATGATTGTTTTCCGTCTCTTCTTCTCCCTTTGTTTTTCTTTCCTAGTCTATGCACAGACACAGACGATAGTTGAT GAGTACGATCCGTCTTTGTAATAAAGTTGTCTTTCTCCTTTTTCATGCTCTTTTCCATCCAGGGCAGGTCAATCC GTGGTCGTAGTCGGAACTTTAGATCCTGCGGGTCTCCCCGTAACCCAGACAATGTAAATAGTATTTTTCGTCCTC CTAAGTGCCACTATTGACTCGATTCGATGCCAGTGAAACCCTGCCTGCAGGAGGGGTGGTAGACCCAAACACGAA CACCCTCACAACTACAGCGGACCCTGCAGCAGCTGCAACGACTACCCCTACAACTACAGTAACACCTCCTGGACA AGGGCCGGTAGATGAGCCTGCTGCAACCACCGGGACGCCTTTCGGTCCTACTCCCTTCACTTACACGACTGAAAT CGACGGTGTCACTACTGCAGTTCTTGACACCTTCAGCCCTACTGATATCGCAACCACCCCGTTTACTCCAACTGC AAGTGGCACTGTCTGGGAATATAGTGACTGGCTCAGCAGTTTTGGTGGATCTCAAGCCACGGCTGCTGCTGCTGC TGGTAGTCGCAATGCGGGACATAGACTAGGCGCTACGGACGCTGTTGTGATGATGATGACGACCTGCTTGTTTTC AGTTTTCCACTTGCTGTGA |