Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082530
Gene name
Locationscaffold_5:1097199..1098113
Strand+
Gene length (bp)914
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 5.6E-47 6 166
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 1.1E-17 6 120
PF00025 Arf ADP-ribosylation factor family 2.6E-06 4 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 1 185 1.0E-55
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 1 185 6.0E-54
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 1 185 7.0E-53
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 1 165 1.0E-52
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 1 185 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 1 185 1.0E-55
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 1 185 6.0E-54
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 1 185 7.0E-53
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 1 165 1.0E-52
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 1 185 2.0E-52
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 1 185 5.0E-52
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 1 185 5.0E-52
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 1 185 2.0E-51
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 1 185 2.0E-51
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 1 185 2.0E-51
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 1 185 2.0E-51
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 1 185 2.0E-51
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 1 185 2.0E-51
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 1 185 2.0E-51
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 1 185 2.0E-51
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 1 185 3.0E-51
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 3 185 2.0E-50
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 1 168 3.0E-50
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 1 168 3.0E-50
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 1 168 3.0E-50
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 1 168 3.0E-50
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 1 185 9.0E-50
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 1 185 6.0E-49
sp|P61227|RAP2B_RAT Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 16 185 6.0E-49
sp|P61226|RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 16 185 6.0E-49
sp|P61225|RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 16 185 6.0E-49
sp|Q06AU2|RAP2A_PIG Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 16 185 6.0E-49
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 3 185 2.0E-48
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 6 185 6.0E-48
sp|Q5R988|RAP2A_PONAB Ras-related protein Rap-2a OS=Pongo abelii GN=RAP2A PE=2 SV=2 16 183 6.0E-48
sp|Q80ZJ1|RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus GN=Rap2a PE=1 SV=2 16 183 6.0E-48
sp|P03967|RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum GN=rasD PE=2 SV=2 1 185 3.0E-47
sp|P23175|RASH_MSVNS GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 1 181 3.0E-47
sp|P34726|RAS2_PHYPO Ras-like protein 2 OS=Physarum polycephalum GN=RAS-2 PE=2 SV=1 3 168 4.0E-47
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 1 167 9.0E-47
sp|P01113|RASH_MSVMO GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 1 181 1.0E-46
sp|Q86L51|RAPB_DICDI Ras-related protein rapB OS=Dictyostelium discoideum GN=rapB PE=3 SV=1 3 185 2.0E-46
sp|P01115|RASH_MSVHA Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 1 181 2.0E-46
sp|P15064|RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum GN=rasG PE=1 SV=1 1 179 2.0E-46
sp|P32252|RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum GN=rasB PE=1 SV=1 16 185 2.0E-46
sp|Q8BU31|RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus GN=Rap2c PE=1 SV=1 16 165 3.0E-46
sp|Q9Y3L5|RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1 16 165 3.0E-46
sp|Q08DI5|RAP2C_BOVIN Ras-related protein Rap-2c OS=Bos taurus GN=RAP2C PE=2 SV=1 16 165 3.0E-46
sp|P70426|RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 3 171 7.0E-46
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 6 166 8.0E-46
sp|Q5R6S2|DIRA2_PONAB GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 4 185 1.0E-45
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 6 166 1.0E-45
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 6 166 1.0E-45
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 6 166 1.0E-45
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 6 179 2.0E-45
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 6 166 2.0E-45
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 6 179 2.0E-45
sp|P01114|RASH_RRASV Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 1 181 2.0E-45
sp|P34729|RAS1_PHYPO Ras-like protein 1 OS=Physarum polycephalum GN=RAS1 PE=2 SV=1 1 170 3.0E-45
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 3 171 3.0E-45
sp|Q95KD9|DIRA2_MACFA GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 4 185 4.0E-45
sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 4 185 5.0E-45
sp|Q5PR73|DIRA2_MOUSE GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 4 185 1.0E-44
sp|P22280|RAS3_MUCCL Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 16 180 1.0E-44
sp|P52498|RSR1_CANAX Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 1 168 1.0E-44
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 1 185 1.0E-44
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 6 185 2.0E-44
sp|P10114|RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1 16 182 4.0E-43
sp|Q99578|RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 3 168 4.0E-43
sp|P08644|RASK_RAT GTPase KRas OS=Rattus norvegicus GN=Kras PE=1 SV=3 1 185 7.0E-43
sp|P32883|RASK_MOUSE GTPase KRas OS=Mus musculus GN=Kras PE=1 SV=1 1 185 7.0E-43
sp|Q04970|RASN_RAT GTPase NRas OS=Rattus norvegicus GN=Nras PE=1 SV=1 16 185 1.0E-42
sp|P01116|RASK_HUMAN GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1 1 185 1.0E-42
sp|P12825|RASN_CAVPO GTPase NRas OS=Cavia porcellus GN=NRAS PE=2 SV=1 16 185 2.0E-42
sp|Q2MJK3|RASN_PIG GTPase NRas OS=Sus scrofa GN=NRAS PE=2 SV=1 16 185 2.0E-42
sp|P01111|RASN_HUMAN GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1 16 185 2.0E-42
sp|Q5BJQ5|RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 3 168 2.0E-42
sp|P08556|RASN_MOUSE GTPase NRas OS=Mus musculus GN=Nras PE=1 SV=1 1 185 3.0E-42
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 6 166 3.0E-42
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 6 166 3.0E-42
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 6 166 3.0E-42
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 6 166 4.0E-42
sp|Q05058|RASL_COPCI 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 16 172 4.0E-42
sp|A8NU18|RASL_COPC7 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 16 172 4.0E-42
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 4 185 4.0E-42
sp|Q5F352|RASN_CHICK GTPase NRas OS=Gallus gallus GN=NRAS PE=2 SV=1 16 185 8.0E-42
sp|P70425|RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 3 168 9.0E-42
sp|Q5RD87|RASN_PONAB GTPase NRas OS=Pongo abelii GN=NRAS PE=2 SV=1 16 185 1.0E-41
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 4 185 1.0E-41
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 12 167 2.0E-41
sp|P10833|RRAS_MOUSE Ras-related protein R-Ras OS=Mus musculus GN=Rras PE=1 SV=1 16 185 2.0E-41
sp|P10301|RRAS_HUMAN Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 16 185 4.0E-41
sp|P22278|RAS1_MUCCL Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 3 185 5.0E-41
sp|P08642|RASH_CHICK GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 1 184 6.0E-41
sp|P22981|LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans GN=let-60 PE=1 SV=1 1 185 8.0E-41
sp|Q9YH38|RASK_CYPCA GTPase KRas OS=Cyprinus carpio GN=kras PE=2 SV=1 1 168 8.0E-41
sp|P79800|RASK_MELGA GTPase KRas OS=Meleagris gallopavo GN=KRAS PE=2 SV=1 1 185 8.0E-41
sp|P28775|RAS_LENED Ras-like protein OS=Lentinula edodes PE=3 SV=1 16 172 8.0E-41
sp|P20171|RASH_RAT GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 1 181 1.0E-40
sp|Q61411|RASH_MOUSE GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 1 181 1.0E-40
sp|P01112|RASH_HUMAN GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 1 181 1.0E-40
sp|Q95ME4|RASN_MONDO GTPase NRas OS=Monodelphis domestica GN=NRAS PE=2 SV=1 16 185 1.0E-40
sp|P05774|RAS_CARAU Ras-like protein (Fragment) OS=Carassius auratus PE=3 SV=1 1 170 2.0E-40
sp|Q5EFX7|RASK_KRYMA GTPase KRas OS=Kryptolebias marmoratus GN=kras PE=2 SV=1 1 168 3.0E-40
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 4 183 3.0E-40
sp|O42277|RASK_ORYLA GTPase KRas OS=Oryzias latipes GN=kras1 PE=2 SV=1 1 168 3.0E-40
sp|P38976|RAS2_HYDVU Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 3 185 3.0E-40
sp|O42785|RASL_COLTR Ras-like protein OS=Colletotrichum trifolii GN=RAS PE=2 SV=1 16 180 4.0E-40
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 6 180 5.0E-40
sp|D3Z8L7|RRAS_RAT Ras-related protein R-Ras OS=Rattus norvegicus GN=Rras PE=1 SV=1 16 185 5.0E-40
sp|Q91806|RASN_XENLA GTPase NRas OS=Xenopus laevis GN=nras PE=2 SV=1 1 183 6.0E-40
sp|O93856|RAS_LACBI Ras-like protein OS=Laccaria bicolor PE=2 SV=1 16 175 1.0E-39
sp|Q07983|RASK_MONDO GTPase KRas OS=Monodelphis domestica GN=KRAS PE=1 SV=1 1 168 1.0E-39
sp|P87018|RAS_BOTFU Ras-like protein OS=Botryotinia fuckeliana GN=ras1 PE=3 SV=1 16 174 2.0E-39
sp|Q12526|RAS_EMENI Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rasA PE=2 SV=2 16 178 2.0E-39
sp|P0CQ42|RAS_CRYNJ Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 16 178 3.0E-39
sp|P0CQ43|RAS_CRYNB Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 16 178 3.0E-39
sp|P22126|RAS1_NEUCR Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 16 168 4.0E-39
sp|Q05147|RASK_XENLA GTPase KRas OS=Xenopus laevis GN=kras PE=2 SV=1 1 168 5.0E-39
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 6 168 5.0E-39
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 6 180 5.0E-39
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 6 168 7.0E-39
sp|P51539|RAS1_HYDVU Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 16 178 2.0E-38
sp|P04388|RAS2_DROME Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 16 185 2.0E-38
sp|P01119|RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 16 166 5.0E-38
sp|P79737|RASN_DANRE GTPase NRas OS=Danio rerio GN=nras PE=2 SV=1 1 172 2.0E-37
sp|Q55BW0|RAPC_DICDI Ras-related protein rapC OS=Dictyostelium discoideum GN=rapC PE=3 SV=1 1 168 4.0E-37
sp|B4LY29|RAS1_DROVI Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 1 167 5.0E-37
sp|B4PUP5|RAS1_DROYA Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|P83831|RAS1_DROSI Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|B4HKC7|RAS1_DROSE Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|P08646|RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 1 167 6.0E-37
sp|P83832|RAS1_DROMA Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|B3NZR4|RAS1_DROER Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|B3M185|RAS1_DROAN Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 1 167 6.0E-37
sp|P01120|RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 16 166 6.0E-37
sp|Q295X7|RAS1_DROPS Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 1 167 7.0E-37
sp|B4GFJ8|RAS1_DROPE Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 1 167 7.0E-37
sp|P62071|RRAS2_MOUSE Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 16 175 9.0E-37
sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 16 175 9.0E-37
sp|Q59XU5|RAS1_CANAL Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 16 167 9.0E-37
sp|C4YKT4|RAS1_CANAW Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 16 167 1.0E-36
sp|B4NJ72|RAS1_DROWI Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 1 167 1.0E-36
sp|B4JFU8|RAS1_DROGR Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 1 167 1.0E-36
sp|P0CY32|RAS1_CANAX Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 16 167 1.0E-36
sp|B4KB60|RAS1_DROMO Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 1 167 7.0E-36
sp|P08647|RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 16 167 1.0E-35
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 6 168 1.0E-34
sp|P97538|RASM_RAT Ras-related protein M-Ras OS=Rattus norvegicus GN=Mras PE=1 SV=2 16 168 2.0E-34
sp|O08989|RASM_MOUSE Ras-related protein M-Ras OS=Mus musculus GN=Mras PE=1 SV=1 16 168 2.0E-34
sp|O95057|DIRA1_HUMAN GTP-binding protein Di-Ras1 OS=Homo sapiens GN=DIRAS1 PE=1 SV=1 12 185 2.0E-34
sp|Q91Z61|DIRA1_MOUSE GTP-binding protein Di-Ras1 OS=Mus musculus GN=Diras1 PE=1 SV=1 12 185 3.0E-34
sp|O14807|RASM_HUMAN Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2 16 168 3.0E-33
sp|Q96A58|RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 2 168 7.0E-30
sp|Q0VCJ7|RERG_BOVIN Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 2 168 2.0E-29
sp|Q550Q4|RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 6 185 2.0E-29
sp|Q8R367|RERG_MOUSE Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 2 168 5.0E-29
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 6 184 1.0E-28
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 6 185 2.0E-28
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 6 185 4.0E-28
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 6 185 5.0E-28
sp|Q9VND8|RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 5 184 1.0E-27
sp|Q96D21|RHES_HUMAN GTP-binding protein Rhes OS=Homo sapiens GN=RASD2 PE=1 SV=1 4 158 2.0E-27
sp|Q56JV3|RHEB_BOVIN GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 6 185 2.0E-27
sp|Q8TAI7|REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 6 167 2.0E-26
sp|Q9Y272|RASD1_HUMAN Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1 4 161 2.0E-26
sp|P63033|RHES_RAT GTP-binding protein Rhes OS=Rattus norvegicus GN=Rasd2 PE=1 SV=1 4 158 3.0E-26
sp|P63032|RHES_MOUSE GTP-binding protein Rhes OS=Mus musculus GN=Rasd2 PE=2 SV=1 4 158 3.0E-26
sp|Q9JKF8|RASD1_RAT Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus GN=Rasd1 PE=1 SV=1 4 161 8.0E-26
sp|O35626|RASD1_MOUSE Dexamethasone-induced Ras-related protein 1 OS=Mus musculus GN=Rasd1 PE=1 SV=1 4 161 8.0E-26
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 4 181 8.0E-25
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 4 176 1.0E-24
sp|Q7TNZ5|REBL1_RAT GTPase RhebL1 OS=Rattus norvegicus GN=Rhebl1 PE=2 SV=1 6 167 2.0E-24
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 4 183 2.0E-24
sp|Q7YS69|REBL1_BOVIN GTPase RhebL1 OS=Bos taurus GN=RHEBL1 PE=2 SV=1 15 167 2.0E-24
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 4 165 3.0E-24
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 4 165 3.0E-24
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 4 165 4.0E-24
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 4 165 4.0E-24
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 4 165 6.0E-24
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 4 185 1.0E-23
sp|Q7Z444|RASE_HUMAN GTPase ERas OS=Homo sapiens GN=ERAS PE=2 SV=1 1 167 2.0E-23
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 4 183 2.0E-23
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 3 180 3.0E-23
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 3 180 3.0E-23
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 3 180 3.0E-23
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 3 180 3.0E-23
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 3 180 3.0E-23
sp|Q9D8T3|REBL1_MOUSE GTPase RhebL1 OS=Mus musculus GN=Rhebl1 PE=2 SV=1 6 173 4.0E-23
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 3 180 5.0E-23
sp|Q6T310|RSLBA_HUMAN Ras-like protein family member 11A OS=Homo sapiens GN=RASL11A PE=2 SV=1 4 169 8.0E-23
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 4 173 8.0E-23
sp|Q6IMB1|RSLBA_MOUSE Ras-like protein family member 11A OS=Mus musculus GN=Rasl11a PE=1 SV=1 4 170 9.0E-23
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 3 180 1.0E-22
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 4 180 1.0E-22
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 4 180 2.0E-22
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 4 180 2.0E-22
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 4 180 2.0E-22
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 4 180 2.0E-22
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 4 180 2.0E-22
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 4 180 2.0E-22
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 4 185 2.0E-22
sp|P25378|RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 3 185 2.0E-22
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 4 165 2.0E-22
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 4 167 2.0E-22
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 4 180 3.0E-22
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 4 165 3.0E-22
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 4 182 3.0E-22
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 4 180 3.0E-22
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 4 180 3.0E-22
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 4 165 3.0E-22
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 4 180 4.0E-22
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 6 180 4.0E-22
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 4 180 5.0E-22
sp|Q08AT1|RASLC_MOUSE Ras-like protein family member 12 OS=Mus musculus GN=Rasl12 PE=2 SV=1 3 168 5.0E-22
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 4 168 5.0E-22
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 4 165 6.0E-22
sp|Q7SZ59|RASLC_DANRE Ras-like protein family member 12 OS=Danio rerio GN=RASL12 PE=2 SV=1 2 175 6.0E-22
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 4 180 7.0E-22
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 4 167 7.0E-22
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 4 165 9.0E-22
sp|Q08E00|RASLC_BOVIN Ras-like protein family member 12 OS=Bos taurus GN=RASL12 PE=2 SV=1 3 168 9.0E-22
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 6 172 9.0E-22
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 4 168 1.0E-21
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 4 183 1.0E-21
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 4 180 1.0E-21
sp|Q6IMA3|RSLBA_RAT Ras-like protein family member 11A OS=Rattus norvegicus GN=Rasl11a PE=2 SV=2 4 169 1.0E-21
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 6 184 2.0E-21
sp|P34443|RHEB1_CAEEL GTP-binding protein Rheb homolog 1 OS=Caenorhabditis elegans GN=rheb-1 PE=3 SV=1 6 165 2.0E-21
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 6 165 2.0E-21
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 4 183 3.0E-21
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 3 174 4.0E-21
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 3 174 4.0E-21
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 3 174 4.0E-21
sp|Q7TN89|RASE_MOUSE GTPase ERas OS=Mus musculus GN=Eras PE=1 SV=1 1 167 4.0E-21
sp|Q9NYN1|RASLC_HUMAN Ras-like protein family member 12 OS=Homo sapiens GN=RASL12 PE=1 SV=1 3 168 5.0E-21
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 4 184 5.0E-21
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 4 184 5.0E-21
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 4 184 5.0E-21
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 4 184 5.0E-21
sp|Q60529|RASH_MESAU GTPase HRas (Fragment) OS=Mesocricetus auratus GN=HRAS PE=3 SV=1 1 93 6.0E-21
sp|P24498|RAS_GEOCY Ras-like protein OS=Geodia cydonium PE=2 SV=1 1 185 6.0E-21
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 6 173 6.0E-21
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 4 185 6.0E-21
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 4 180 6.0E-21
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 4 168 6.0E-21
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 6 167 6.0E-21
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 6 158 7.0E-21
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 4 168 7.0E-21
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 4 181 8.0E-21
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 4 184 8.0E-21
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 3 167 1.0E-20
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 4 172 1.0E-20
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 4 168 1.0E-20
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 4 168 1.0E-20
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 6 172 2.0E-20
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 6 174 2.0E-20
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 6 161 2.0E-20
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 6 173 2.0E-20
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 6 173 2.0E-20
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 6 173 2.0E-20
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 3 168 3.0E-20
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 3 168 3.0E-20
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 3 168 3.0E-20
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 3 180 3.0E-20
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 3 168 3.0E-20
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 4 175 4.0E-20
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 3 179 4.0E-20
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 4 168 4.0E-20
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 3 180 4.0E-20
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 3 167 4.0E-20
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 3 180 5.0E-20
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 3 180 6.0E-20
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 3 180 6.0E-20
sp|Q96S79|RSLAB_HUMAN Ras-like protein family member 10B OS=Homo sapiens GN=RASL10B PE=2 SV=1 1 165 6.0E-20
sp|Q5SSG5|RSLAB_MOUSE Ras-like protein family member 10B OS=Mus musculus GN=Rasl10b PE=1 SV=1 1 165 6.0E-20
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 6 168 6.0E-20
sp|O35929|REM1_MOUSE GTP-binding protein REM 1 OS=Mus musculus GN=Rem1 PE=1 SV=1 4 173 6.0E-20
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 4 172 7.0E-20
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 4 172 8.0E-20
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 4 172 8.0E-20
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 4 172 8.0E-20
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 4 172 8.0E-20
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 4 172 8.0E-20
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 4 172 8.0E-20
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 4 172 8.0E-20
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 3 174 8.0E-20
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 4 165 8.0E-20
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 6 168 8.0E-20
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 4 172 9.0E-20
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 4 168 9.0E-20
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 4 172 9.0E-20
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 4 168 1.0E-19
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 4 165 1.0E-19
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 4 158 1.0E-19
sp|Q5R541|GEM_PONAB GTP-binding protein GEM OS=Pongo abelii GN=GEM PE=2 SV=1 4 166 1.0E-19
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 4 165 1.0E-19
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 4 168 1.0E-19
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 4 168 1.0E-19
sp|O88667|RAD_MOUSE GTP-binding protein RAD OS=Mus musculus GN=Rrad PE=1 SV=1 4 180 1.0E-19
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 4 168 1.0E-19
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 4 168 1.0E-19
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 4 168 1.0E-19
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 6 158 2.0E-19
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 6 173 2.0E-19
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 4 172 2.0E-19
sp|A1DZY4|RSLBL_DANRE Ras-like protein family member 11A-like OS=Danio rerio GN=zgc:110179 PE=2 SV=1 6 180 2.0E-19
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 6 168 2.0E-19
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 6 168 3.0E-19
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 6 168 3.0E-19
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 4 181 3.0E-19
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 4 181 3.0E-19
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 4 181 3.0E-19
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 4 181 3.0E-19
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 6 185 3.0E-19
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 6 168 3.0E-19
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 6 168 3.0E-19
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 6 168 3.0E-19
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 6 180 3.0E-19
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 4 168 3.0E-19
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 4 165 3.0E-19
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 4 170 3.0E-19
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 3 174 3.0E-19
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 6 180 3.0E-19
sp|P55041|GEM_MOUSE GTP-binding protein GEM OS=Mus musculus GN=Gem PE=1 SV=2 4 166 4.0E-19
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 4 162 4.0E-19
sp|P55040|GEM_HUMAN GTP-binding protein GEM OS=Homo sapiens GN=GEM PE=1 SV=1 4 166 4.0E-19
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 3 174 5.0E-19
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 4 172 5.0E-19
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 4 168 5.0E-19
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 4 165 5.0E-19
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 4 181 6.0E-19
sp|Q922H7|RSLBB_MOUSE Ras-like protein family member 11B OS=Mus musculus GN=Rasl11b PE=2 SV=1 6 179 6.0E-19
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 4 173 6.0E-19
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 3 165 7.0E-19
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 4 173 7.0E-19
sp|Q92737|RSLAA_HUMAN Ras-like protein family member 10A OS=Homo sapiens GN=RASL10A PE=1 SV=1 2 163 8.0E-19
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 4 158 9.0E-19
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 4 171 1.0E-18
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 4 171 1.0E-18
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 4 171 1.0E-18
sp|Q6IMA7|RSLBB_RAT Ras-like protein family member 11B OS=Rattus norvegicus GN=Rasl11b PE=2 SV=1 6 179 1.0E-18
sp|Q75J93|CPAS1_DICDI Circularly permutated Ras protein 1 OS=Dictyostelium discoideum GN=cpras1 PE=3 SV=1 53 164 1.0E-18
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 4 169 1.0E-18
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 6 179 1.0E-18
sp|Q8AVS6|RSLBB_XENLA Ras-like protein family member 11B OS=Xenopus laevis GN=rasl11b PE=2 SV=1 6 168 2.0E-18
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 4 165 2.0E-18
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 4 168 2.0E-18
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 4 165 2.0E-18
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 4 170 2.0E-18
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 4 165 2.0E-18
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 4 165 2.0E-18
sp|Q9BPW5|RSLBB_HUMAN Ras-like protein family member 11B OS=Homo sapiens GN=RASL11B PE=2 SV=1 6 179 2.0E-18
sp|Q91079|RAS_LIMLI Ras-like protein (Fragment) OS=Limanda limanda GN=ras PE=3 SV=1 16 97 2.0E-18
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 4 165 3.0E-18
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 4 181 4.0E-18
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 6 175 4.0E-18
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 4 170 4.0E-18
sp|P55042|RAD_HUMAN GTP-binding protein RAD OS=Homo sapiens GN=RRAD PE=1 SV=2 4 166 4.0E-18
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 4 165 4.0E-18
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 6 168 4.0E-18
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 4 183 5.0E-18
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 4 183 5.0E-18
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 4 180 5.0E-18
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 3 178 5.0E-18
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 4 165 6.0E-18
sp|Q8K5A4|RSLAA_MOUSE Ras-like protein family member 10A OS=Mus musculus GN=Rasl10a PE=2 SV=1 2 163 6.0E-18
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 4 185 6.0E-18
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 4 165 7.0E-18
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 4 165 8.0E-18
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 3 165 9.0E-18
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 4 162 9.0E-18
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 4 159 1.0E-17
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 4 159 1.0E-17
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 4 159 1.0E-17
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 6 173 1.0E-17
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 6 163 1.0E-17
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 3 178 1.0E-17
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 6 165 1.0E-17
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 4 171 1.0E-17
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 6 175 1.0E-17
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 4 185 1.0E-17
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 6 168 1.0E-17
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 4 165 1.0E-17
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 4 165 1.0E-17
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 4 168 1.0E-17
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 4 162 1.0E-17
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 6 165 2.0E-17
sp|O95661|DIRA3_HUMAN GTP-binding protein Di-Ras3 OS=Homo sapiens GN=DIRAS3 PE=1 SV=1 12 185 2.0E-17
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 6 163 2.0E-17
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 4 170 2.0E-17
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 4 158 2.0E-17
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 4 162 2.0E-17
sp|P55043|RAD_RAT GTP-binding protein RAD OS=Rattus norvegicus GN=Rrad PE=2 SV=2 2 180 2.0E-17
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 6 173 2.0E-17
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 3 173 2.0E-17
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 1 165 2.0E-17
sp|Q6P0U3|RSLBB_DANRE Ras-like protein family member 11B OS=Danio rerio GN=rasl11b PE=2 SV=1 4 167 2.0E-17
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 4 165 2.0E-17
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 4 162 3.0E-17
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 4 162 3.0E-17
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 6 175 3.0E-17
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 6 167 3.0E-17
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 4 172 3.0E-17
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 6 179 3.0E-17
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 1 165 3.0E-17
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 3 165 3.0E-17
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 3 165 3.0E-17
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 6 175 3.0E-17
sp|A8XAD0|RHEB1_CAEBR GTP-binding protein Rheb homolog 1 OS=Caenorhabditis briggsae GN=rheb-1 PE=3 SV=1 6 184 3.0E-17
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 4 172 3.0E-17
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 6 177 3.0E-17
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 6 185 3.0E-17
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 4 165 4.0E-17
sp|O75628|REM1_HUMAN GTP-binding protein REM 1 OS=Homo sapiens GN=REM1 PE=1 SV=2 4 158 4.0E-17
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 4 167 4.0E-17
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 4 165 4.0E-17
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 4 171 4.0E-17
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 4 165 4.0E-17
sp|Q7GD79|RAN2_ORYSJ GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1 4 165 4.0E-17
sp|A2Y7R5|RAN2_ORYSI GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1 4 165 4.0E-17
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 6 163 4.0E-17
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 4 165 5.0E-17
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 4 182 5.0E-17
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 4 158 6.0E-17
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 4 165 6.0E-17
sp|Q5FVY2|RSLBB_XENTR Ras-like protein family member 11B OS=Xenopus tropicalis GN=rasl11b PE=2 SV=1 6 168 6.0E-17
sp|Q5E9J3|RSLBB_BOVIN Ras-like protein family member 11B OS=Bos taurus GN=RASL11B PE=2 SV=1 6 179 7.0E-17
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 6 163 7.0E-17
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 6 173 7.0E-17
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 4 165 7.0E-17
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 4 165 8.0E-17
sp|Q8TFK3|GSP1_YARLI GTP-binding nuclear protein GSP1/Ran OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GSP1 PE=3 SV=1 1 165 9.0E-17
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 6 163 9.0E-17
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 4 168 1.0E-16
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 4 174 1.0E-16
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 4 162 1.0E-16
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 4 174 1.0E-16
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 4 185 1.0E-16
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 4 174 1.0E-16
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 4 165 1.0E-16
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 4 165 1.0E-16
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 6 185 1.0E-16
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 6 167 1.0E-16
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 4 162 2.0E-16
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 4 162 2.0E-16
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 4 158 2.0E-16
sp|Q9UBK7|RBL2A_HUMAN Rab-like protein 2A OS=Homo sapiens GN=RABL2A PE=1 SV=1 6 171 2.0E-16
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 4 168 2.0E-16
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 6 163 2.0E-16
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 4 168 2.0E-16
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 4 165 2.0E-16
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 4 166 2.0E-16
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 4 171 2.0E-16
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 4 171 2.0E-16
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 4 171 2.0E-16
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 4 163 2.0E-16
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 4 171 3.0E-16
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 4 171 3.0E-16
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 4 171 3.0E-16
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 4 171 3.0E-16
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 6 185 3.0E-16
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 4 185 3.0E-16
sp|Q7F7I7|RAN1_ORYSJ GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1 4 165 3.0E-16
sp|A2WSI7|RAN1_ORYSI GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2 4 165 3.0E-16
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 4 162 3.0E-16
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 4 176 3.0E-16
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 4 165 4.0E-16
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 4 174 4.0E-16
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 6 163 4.0E-16
sp|P54765|RAN1A_LOTJA GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1 4 165 4.0E-16
sp|P54766|RAN1B_LOTJA GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1 4 165 4.0E-16
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 4 172 4.0E-16
sp|Q6DGN0|RERGL_DANRE Ras-related and estrogen-regulated growth inhibitor-like protein OS=Danio rerio GN=rergl PE=2 SV=1 1 163 4.0E-16
sp|Q9UNT1|RBL2B_HUMAN Rab-like protein 2B OS=Homo sapiens GN=RABL2B PE=2 SV=1 6 171 4.0E-16
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 6 165 4.0E-16
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 6 167 5.0E-16
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 6 163 5.0E-16
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 4 172 5.0E-16
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 4 165 5.0E-16
sp|P41918|RANA1_TOBAC GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1 4 165 5.0E-16
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 1 185 5.0E-16
sp|Q8H156|RAN3_ARATH GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2 4 165 5.0E-16
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 1 158 5.0E-16
sp|P38547|RAN2_SOLLC GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1 4 165 5.0E-16
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 4 162 5.0E-16
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 4 162 5.0E-16
sp|P38546|RAN1_SOLLC GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1 4 165 6.0E-16
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 4 171 6.0E-16
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 6 172 6.0E-16
sp|P41919|RANB1_TOBAC GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1 4 165 6.0E-16
sp|P41916|RAN1_ARATH GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 4 165 6.0E-16
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 4 162 6.0E-16
sp|P38548|RAN_VICFA GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1 4 165 6.0E-16
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 4 165 7.0E-16
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 4 162 8.0E-16
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 4 162 8.0E-16
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 6 177 8.0E-16
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 4 162 8.0E-16
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 4 162 8.0E-16
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 4 162 8.0E-16
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 4 171 8.0E-16
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 4 162 8.0E-16
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 4 162 8.0E-16
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 4 178 9.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082530
MGQFNVVVLGAGGVGKSALTVRFIRDEFIENYDPTIEEEYRRAITVDGETSSLEVLDTSGAEQFTSMHEVYIKAG
KGFILVFSLTQETSLKEVDYLRKQIFRIKGNDSRVPIVIAGTKLDLVNEREVPTNTIQTLASRWQLPFYETSAKR
NWHIDDIFNDLVRQMRKQYRQQDGPKKSKGPCVIM*
Coding >AgabiH97|082530
ATGGGCCAGTTTAATGTCGTCGTTCTAGGCGCCGGAGGTGTTGGCAAGTCTGCCCTCACAGTACGCTTCATACGG
GATGAATTTATCGAGAACTATGACCCAACAATCGAGGAGGAGTACCGCCGTGCTATCACGGTCGATGGTGAAACG
TCTTCGCTCGAAGTGCTCGATACCTCTGGCGCTGAGCAGTTCACATCCATGCATGAAGTCTATATCAAGGCTGGC
AAGGGCTTCATACTCGTGTTCAGCCTTACACAAGAAACCAGTCTGAAAGAGGTCGACTATCTTCGGAAGCAGATT
TTTCGAATCAAAGGCAACGATTCTAGGGTGCCAATAGTGATTGCTGGAACGAAACTGGACCTTGTGAACGAGCGG
GAGGTACCGACGAATACAATTCAGACTCTAGCCAGTCGCTGGCAGCTTCCCTTCTATGAAACCTCAGCCAAGCGA
AATTGGCACATTGATGATATTTTTAACGACCTTGTTCGGCAAATGAGGAAGCAATACCGGCAGCAGGACGGACCC
AAGAAGAGCAAAGGGCCTTGTGTTATTATGTAA
Transcript >AgabiH97|082530
ATGGGCCAGTTTAATGTCGTCGTTCTAGGCGCCGGAGGTGTTGGCAAGTCTGCCCTCACAGTACGCTTCATACGG
GATGAATTTATCGAGAACTATGACCCAACAATCGAGGAGGAGTACCGCCGTGCTATCACGGTCGATGGTGAAACG
TCTTCGCTCGAAGTGCTCGATACCTCTGGCGCTGAGCAGTTCACATCCATGCATGAAGTCTATATCAAGGCTGGC
AAGGGCTTCATACTCGTGTTCAGCCTTACACAAGAAACCAGTCTGAAAGAGGTCGACTATCTTCGGAAGCAGATT
TTTCGAATCAAAGGCAACGATTCTAGGGTGCCAATAGTGATTGCTGGAACGAAACTGGACCTTGTGAACGAGCGG
GAGGTACCGACGAATACAATTCAGACTCTAGCCAGTCGCTGGCAGCTTCCCTTCTATGAAACCTCAGCCAAGCGA
AATTGGCACATTGATGATATTTTTAACGACCTTGTTCGGCAAATGAGGAAGCAATACCGGCAGCAGGACGGACCC
AAGAAGAGCAAAGGGCCTTGTGTTATTATGTAA
Gene >AgabiH97|082530
ATGGGCCAGTTTAATGTCGTCGTTCTAGGCGGTCAGTCATCCTTCTCATCTCTGACACACCACCAACCACGTTCC
AGCCGGAGGTGTTGGCAAGTCTGCCCTCACAGGCAAGTTCACTCAGCATTTCCAGTTCCCTGCAACTCATTGATC
GTCACCAGTACGCTTCATACGGGATGAATTTATCGAGAACTATGACCCAACAATCGAGGGTAACCAATATCGCTA
CTCCGATTTCGTTGTCCTGACCCAGCCCCATTCAGAGGAGTACCGCCGTGCTATCACGGTCGATGGTGAAACGTC
TTCGGTTCGGTGCCCGTTACAGGTGTATTGCACAGCATGCTGATATTGCCCCCAACCCAGCTCGAAGTGCTCGAT
ACCTCTGGCGCTGAGCAGTTCACATCCATGCATGAAGTCTATATCAAGGTGAGCGATCGTCTATGTGTCCCAAGT
TCTTTCCCTTGACGATATCCTACAGGCTGGCAAGGGCTTCATACTCGTGTTCAGGTGTGTATCATTCGACCTTAC
AACGGCATTCGCTTTACGACACCGAACAGCCTTACACAAGAAACCAGTCTGAAAGAGGTCGACTATCTTCGGAAG
CAGATTTTTCGAATCAAAGGCAACGATTCTGTAAGTGAAGTCATGACAGACTATACAAAGAGTCTCATGCGTTCA
CATAGAGGGTGCCAATAGTGATTGCTGGAACGAAACTGGACCTTGTGAACGAGCGGGAGGTACCGACGAATACAA
TTCAGACTCTAGCCAGTCGCTGGCAGCTTCCCTTCTATGAAACCTCAGCCAAGCGAAATTGGCACATTGATGATA
TTTTTAACGACCTTGTTCGGCAAATGAGGAAGCAATACCGGCAGCAGGACGGACCCAAGAAGAGCAAAGGGCCTT
GTGTTATTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail