Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082340
Gene name
Locationscaffold_5:1043992..1046128
Strand+
Gene length (bp)2136
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 9.6E-39 473 575
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.5E-37 445 541
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 4.4E-19 220 379
PF08284 RVP_2 Retroviral aspartyl protease 4.7E-10 2 97
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 1.5E-06 1 82
PF13650 Asp_protease_2 Aspartyl protease 3.3E-05 1 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 1 710 1.0E-88
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 1 710 1.0E-88
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 1 710 1.0E-88
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 1 710 1.0E-88
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 1 710 1.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 1 710 1.0E-88
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 1 710 1.0E-88
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 1 710 1.0E-88
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 1 710 1.0E-88
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 1 710 1.0E-88
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 1 710 1.0E-88
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 1 710 1.0E-88
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 1 710 1.0E-88
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 1 710 2.0E-88
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 1 710 2.0E-88
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 1 710 3.0E-88
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 156 596 4.0E-81
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 183 710 6.0E-81
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 183 710 2.0E-80
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 153 596 1.0E-79
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 173 596 4.0E-70
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 156 595 2.0E-62
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 178 596 5.0E-57
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 178 595 1.0E-41
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 176 593 6.0E-41
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 1 595 7.0E-41
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 1 595 3.0E-40
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 159 595 6.0E-40
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 1 595 6.0E-40
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 159 595 2.0E-38
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 1 590 1.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 185 597 3.0E-33
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 175 595 4.0E-32
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 175 595 6.0E-32
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 213 601 2.0E-30
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 1 590 6.0E-30
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 1 589 5.0E-27
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 174 576 2.0E-23
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 190 602 2.0E-23
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 206 595 3.0E-23
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 174 525 4.0E-23
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 174 525 4.0E-23
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 174 525 5.0E-23
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 176 629 8.0E-23
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 174 525 9.0E-23
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 211 549 1.0E-22
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 174 525 1.0E-22
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 173 632 1.0E-22
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 176 525 2.0E-22
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 174 525 3.0E-22
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 174 508 3.0E-22
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 174 576 3.0E-22
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 174 525 5.0E-22
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 164 529 2.0E-20
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 133 530 3.0E-20
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 166 529 5.0E-19
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 226 322 8.0E-19
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 213 424 2.0E-18
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 164 529 3.0E-18
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 352 494 2.0E-16
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 164 529 3.0E-15
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 163 529 1.0E-14
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 383 508 2.0E-11
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 383 508 3.0E-09
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 187 498 4.0E-09
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 187 504 5.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 187 463 5.0E-09
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 1 272 6.0E-09
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 187 432 1.0E-08
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 187 435 4.0E-08
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 187 435 5.0E-08
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 158 498 1.0E-07
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 196 435 2.0E-07
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 187 435 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082340
MVDSGCTHTCIDKRLVKKKKIPTKKLEQPITCRNSDGTIAGKKDITKFAKIDININGHNEQLDAVVTPLQSSDLF
LGHDWLTNHNPEINWKQGVIKFNRCPTSCSFPHTDISFEPRIRRLQSNEDTEEKEPDPTNPEDLPTYMKPFAHLF
NKKNFDKLPEQTEWDHKINFTENTPTEISSKVYSMTPLEREELDKFLDENLATNQIRPSKSPYAAPCFFVPKKDG
SLRLCQDYRKLNEITIKDKTPLPLISEVLDQLKDAKVFNKLDIIWGYNNIRIREGDEWKAAFLTNRGLFEPTVMF
FGMSNSPATFSRMMATIFREMIQDGSLANYMDDFIIPAKDDEELEARTLRFLKIAEKHNLSFKRTKCEFNVSSTT
VLGTVIGNGKATMEEEKVKAIRDWAVPTTVKQVESFLGFANFYRRFIKNFSTIAQPLNELKSKKGEKWYWNDEQQ
QAFEQIKQAIASEPILALPKDKGQFRVEVDASNYGTGAVLSQEQEDKWHPVAFMSKTLSEAERNYEIYDKELLAI
IKALKLWRHYLLDAKEQFEIWTDHENLKYFREPQKLNARQARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPD
TSNDNRGVEMFKEKMFIRRLEESIPIYDITLLHNQRFEIIADETLLEKIRKCERRETRVIEEMKKKPEKVWENNG
IIYQQGRIYVPDNQEIRGFILHDHHNSPDAGHPGMY*
Coding >AgabiH97|082340
ATGGTCGACTCGGGATGCACACACACATGTATTGACAAAAGACTAGTAAAGAAGAAGAAGATCCCAACGAAGAAA
TTGGAACAGCCGATCACATGCAGGAATTCAGATGGAACAATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAA
ATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTT
CTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGGAAACAAGGAGTTATCAAATTCAACCGGTGC
CCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCACGTATACGACGATTACAGTCAAACGAAGAC
ACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCCACATACATGAAACCCTTCGCCCATCTTTTC
AACAAAAAGAACTTTGACAAGCTTCCTGAACAAACGGAATGGGATCACAAAATCAACTTCACAGAAAACACACCA
ACAGAAATTTCATCGAAGGTTTATAGCATGACACCACTGGAAAGAGAAGAATTGGACAAATTTTTGGATGAAAAC
CTGGCTACCAATCAAATCCGACCATCGAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGT
TCACTACGGTTATGTCAGGATTACAGGAAACTGAACGAGATCACGATCAAGGACAAGACGCCACTACCCCTCATC
AGTGAAGTATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGACATTATCTGGGGATATAACAACATT
CGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAATCGCGGATTATTTGAACCAACGGTCATGTTC
TTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGATGGA
TCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTCTACGT
TTTCTCAAAATCGCGGAGAAACACAATTTATCATTCAAACGGACAAAATGCGAGTTCAATGTCTCATCAACAACG
GTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCG
GTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAGAATTTC
AGCACCATCGCGCAACCACTAAACGAACTGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAACAA
CAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGATCTTAGCGTTACCCAAGGACAAAGGACAATTC
AGAGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCA
GTCGCATTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTACGAGATCTACGACAAGGAACTACTAGCTATC
ATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAGGAGCAATTCGAGATATGGACAGATCACGAG
AACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATAC
GATTTCCTGCTACGACACATTCCTGGGAAGACGAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGAC
ACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATGTTCATCCGAAGACTTGAAGAATCCATCCCC
ATCTATGACATCACCTTACTCCACAATCAAAGATTCGAAATCATAGCCGATGAAACCCTACTTGAGAAGATTAGG
AAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAGAAGCCAGAAAAAGTATGGGAGAACAATGGA
ATCATTTACCAACAAGGAAGGATCTATGTTCCGGATAATCAGGAGATCAGAGGTTTCATTCTTCACGATCATCAT
AATTCCCCCGACGCTGGACATCCTGGAATGTACTGA
Transcript >AgabiH97|082340
ATGGTCGACTCGGGATGCACACACACATGTATTGACAAAAGACTAGTAAAGAAGAAGAAGATCCCAACGAAGAAA
TTGGAACAGCCGATCACATGCAGGAATTCAGATGGAACAATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAA
ATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTT
CTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGGAAACAAGGAGTTATCAAATTCAACCGGTGC
CCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCACGTATACGACGATTACAGTCAAACGAAGAC
ACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCCACATACATGAAACCCTTCGCCCATCTTTTC
AACAAAAAGAACTTTGACAAGCTTCCTGAACAAACGGAATGGGATCACAAAATCAACTTCACAGAAAACACACCA
ACAGAAATTTCATCGAAGGTTTATAGCATGACACCACTGGAAAGAGAAGAATTGGACAAATTTTTGGATGAAAAC
CTGGCTACCAATCAAATCCGACCATCGAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGT
TCACTACGGTTATGTCAGGATTACAGGAAACTGAACGAGATCACGATCAAGGACAAGACGCCACTACCCCTCATC
AGTGAAGTATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGACATTATCTGGGGATATAACAACATT
CGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAATCGCGGATTATTTGAACCAACGGTCATGTTC
TTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGATGGA
TCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTCTACGT
TTTCTCAAAATCGCGGAGAAACACAATTTATCATTCAAACGGACAAAATGCGAGTTCAATGTCTCATCAACAACG
GTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCG
GTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAGAATTTC
AGCACCATCGCGCAACCACTAAACGAACTGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAACAA
CAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGATCTTAGCGTTACCCAAGGACAAAGGACAATTC
AGAGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCA
GTCGCATTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTACGAGATCTACGACAAGGAACTACTAGCTATC
ATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAGGAGCAATTCGAGATATGGACAGATCACGAG
AACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATAC
GATTTCCTGCTACGACACATTCCTGGGAAGACGAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGAC
ACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATGTTCATCCGAAGACTTGAAGAATCCATCCCC
ATCTATGACATCACCTTACTCCACAATCAAAGATTCGAAATCATAGCCGATGAAACCCTACTTGAGAAGATTAGG
AAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAGAAGCCAGAAAAAGTATGGGAGAACAATGGA
ATCATTTACCAACAAGGAAGGATCTATGTTCCGGATAATCAGGAGATCAGAGGTTTCATTCTTCACGATCATCAT
AATTCCCCCGACGCTGGACATCCTGGAATGTACTGA
Gene >AgabiH97|082340
ATGGTCGACTCGGGATGCACACACACATGTATTGACAAAAGACTAGTAAAGAAGAAGAAGATCCCAACGAAGAAA
TTGGAACAGCCGATCACATGCAGGAATTCAGATGGAACAATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAA
ATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTT
CTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGGAAACAAGGAGTTATCAAATTCAACCGGTGC
CCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCACGTATACGACGATTACAGTCAAACGAAGAC
ACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCCACATACATGAAACCCTTCGCCCATCTTTTC
AACAAAAAGAACTTTGACAAGCTTCCTGAACAAACGGAATGGGATCACAAAATCAACTTCACAGAAAACACACCA
ACAGAAATTTCATCGAAGGTTTATAGCATGACACCACTGGAAAGAGAAGAATTGGACAAATTTTTGGATGAAAAC
CTGGCTACCAATCAAATCCGACCATCGAAATCACCTTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGT
TCACTACGGTTATGTCAGGATTACAGGAAACTGAACGAGATCACGATCAAGGACAAGACGCCACTACCCCTCATC
AGTGAAGTATTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGACATTATCTGGGGATATAACAACATT
CGGATACGAGAAGGAGATGAATGGAAAGCAGCATTCTTGACGAATCGCGGATTATTTGAACCAACGGTCATGTTC
TTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGATGGA
TCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTCTACGT
TTTCTCAAAATCGCGGAGAAACACAATTTATCATTCAAACGGACAAAATGCGAGTTCAATGTCTCATCAACAACG
GTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCG
GTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAGAATTTC
AGCACCATCGCGCAACCACTAAACGAACTGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAACAA
CAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGATCTTAGCGTTACCCAAGGACAAAGGACAATTC
AGAGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCA
GTCGCATTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTACGAGATCTACGACAAGGAACTACTAGCTATC
ATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAGGAGCAATTCGAGATATGGACAGATCACGAG
AACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAAGCGAGATGGTACCTCATGCTACAGGAATAC
GATTTCCTGCTACGACACATTCCTGGGAAGACGAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGAC
ACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATGTTCATCCGAAGACTTGAAGAATCCATCCCC
ATCTATGACATCACCTTACTCCACAATCAAAGATTCGAAATCATAGCCGATGAAACCCTACTTGAGAAGATTAGG
AAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAGAAGCCAGAAAAAGTATGGGAGAACAATGGA
ATCATTTACCAACAAGGAAGGATCTATGTTCCGGATAATCAGGAGATCAGAGGTTTCATTCTTCACGATCATCAT
AATTCCCCCGACGCTGGACATCCTGGAATGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail