Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082170
Gene name
Locationscaffold_5:1002906..1004124
Strand-
Gene length (bp)1218
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 5.4E-12 62 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 9 397 1.0E-10

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3316 0.5079 0.196 0.0515 0.0291 0.0713 0.1504 0.2284 0.1168 0.0045

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup108
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|018120
Agaricus bisporus var bisporus H39 AgabiH39|525900
Agaricus bisporus var bisporus H39 AgabiH39|523300
Agaricus bisporus var bisporus H39 AgabiH39|521400
Agaricus bisporus var bisporus H39 AgabiH39|500800
Agaricus bisporus var bisporus H39 AgabiH39|500100
Agaricus bisporus var bisporus H39 AgabiH39|477900
Agaricus bisporus var bisporus H39 AgabiH39|463200
Agaricus bisporus var bisporus H39 AgabiH39|544300
Agaricus bisporus var bisporus H39 AgabiH39|352000
Agaricus bisporus var bisporus H39 AgabiH39|251700
Agaricus bisporus var bisporus H39 AgabiH39|224200
Agaricus bisporus var bisporus H39 AgabiH39|219000
Agaricus bisporus var bisporus H39 AgabiH39|094220
Agaricus bisporus var bisporus H39 AgabiH39|082170
Agaricus bisporus var bisporus H39 AgabiH39|082100
Agaricus bisporus var bisporus H39 AgabiH39|395600
Agaricus bisporus var bisporus H97 AgabiH97|082170 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|082100
Agaricus bisporus var bisporus H97 AgabiH97|081980
Agaricus bisporus var bisporus H97 AgabiH97|075700
Agaricus bisporus var bisporus H97 AgabiH97|060560
Agaricus bisporus var bisporus H97 AgabiH97|044940
Agaricus bisporus var bisporus H97 AgabiH97|036790
Agaricus bisporus var bisporus H97 AgabiH97|031000
Agaricus bisporus var bisporus H97 AgabiH97|031110
Agaricus bisporus var bisporus H97 AgabiH97|030970
Agaricus bisporus var bisporus H97 AgabiH97|025340
Agaricus bisporus var bisporus H97 AgabiH97|018120
Agaricus bisporus var bisporus H97 AgabiH97|013110
Agaricus bisporus var bisporus H97 AgabiH97|031120
Rhodonia placenta FPRL280 RhoplFPRL280|1672_1
Rhodonia placenta FPRL280 RhoplFPRL280|1578_1
Rhodonia placenta FPRL280 RhoplFPRL280|317_7

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082170
MASGSPTFAKLNEENYSTWSGEMEAWLRASGLWRLVSGRQKAPSTSSPVTQAEADALDAFEARLDKAAGWLYLMV
EQEQGIHFSGIQDSPVKMWEALEAVHRQKRAGMRFNAYDELFPIRKLEEESLQSLINRVESSKRKIKELRPSSFT
LEMLDDELTSMALIRALPDEFSAFTSSLLLMDKLDKSTIHQTFVTEDLQHKKRAQDASTSSHALAACSGSQNTLK
TCDFCGREGHKFSECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTHAPKKAQRVTEFAGNASTPHPSP
SPSPSTPLQLDADFHWLADTGATSHMTPHRHWFKSYTSHKIPIRLADNSIVYSLGVGSVVFEPVVNGKVVRAVEL
TRVLHVPALRSNLLSCLYLARNKGFNITIC*
Coding >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG
Transcript >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG
Gene >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail