Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082170
Gene name
Locationscaffold_5:1002906..1004124
Strand-
Gene length (bp)1218
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 5.4E-12 62 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 9 397 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082170
MASGSPTFAKLNEENYSTWSGEMEAWLRASGLWRLVSGRQKAPSTSSPVTQAEADALDAFEARLDKAAGWLYLMV
EQEQGIHFSGIQDSPVKMWEALEAVHRQKRAGMRFNAYDELFPIRKLEEESLQSLINRVESSKRKIKELRPSSFT
LEMLDDELTSMALIRALPDEFSAFTSSLLLMDKLDKSTIHQTFVTEDLQHKKRAQDASTSSHALAACSGSQNTLK
TCDFCGREGHKFSECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTHAPKKAQRVTEFAGNASTPHPSP
SPSPSTPLQLDADFHWLADTGATSHMTPHRHWFKSYTSHKIPIRLADNSIVYSLGVGSVVFEPVVNGKVVRAVEL
TRVLHVPALRSNLLSCLYLARNKGFNITIC*
Coding >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG
Transcript >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG
Gene >AgabiH97|082170
ATGGCCTCCGGATCGCCCACCTTCGCGAAACTCAATGAGGAGAACTACTCCACATGGTCTGGAGAGATGGAAGCG
TGGCTGAGAGCCTCTGGCCTCTGGAGACTTGTCTCAGGCAGGCAGAAGGCTCCCTCCACCTCTAGCCCTGTTACC
CAGGCCGAAGCGGACGCTCTGGACGCGTTTGAGGCTCGCTTGGACAAGGCTGCAGGCTGGCTATACCTTATGGTT
GAGCAGGAGCAAGGGATTCACTTCTCTGGCATCCAGGACAGTCCAGTGAAGATGTGGGAGGCTCTAGAGGCTGTA
CATCGACAGAAAAGGGCTGGAATGCGCTTTAATGCCTATGATGAGCTCTTCCCTATCCGAAAACTTGAGGAGGAG
TCCCTCCAATCACTTATCAACAGAGTAGAGAGCTCTAAACGCAAAATCAAGGAACTCCGCCCCTCCTCCTTCACT
CTAGAGATGCTAGATGATGAGCTAACCTCTATGGCTCTCATCAGAGCTCTCCCCGACGAATTTTCCGCCTTCACC
TCCTCCCTATTGCTTATGGACAAATTAGACAAGTCCACCATTCATCAAACCTTTGTTACTGAGGATTTACAACAC
AAAAAACGCGCTCAGGACGCCTCTACCTCCTCCCATGCACTAGCTGCTTGCTCTGGCTCTCAAAACACGTTGAAA
ACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCCCGGGCT
CAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGCTCTAGC
TCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCT
TCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACTTCTCAT
ATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAACTCCATT
GTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTTGAGTTG
ACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAGGGCTTC
AATATCACCATCTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail