Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|082100
Gene name
Locationscaffold_5:983815..985573
Strand+
Gene length (bp)1758
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 7.2E-10 14 129
PF13976 gag_pre-integrs GAG-pre-integrase domain 5.5E-09 359 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 544 2.0E-40
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 154 544 3.0E-22
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 242 535 7.0E-12
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 242 535 8.0E-12
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 242 535 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 14 544 2.0E-40
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 154 544 3.0E-22
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 242 535 7.0E-12
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 242 535 8.0E-12
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 242 535 8.0E-12
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 242 535 8.0E-12
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 242 535 8.0E-12
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 242 535 9.0E-12
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 242 535 9.0E-12
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 242 535 9.0E-12
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 242 535 9.0E-12
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 242 535 9.0E-12
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 242 535 9.0E-12
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 242 535 3.0E-11
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 171 535 4.0E-11
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 164 535 5.0E-11
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 171 529 5.0E-11
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 171 529 6.0E-11
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 171 535 6.0E-11
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 171 529 6.0E-11
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 171 535 6.0E-11
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 171 535 6.0E-11
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 171 529 7.0E-11
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 171 535 7.0E-11
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 171 529 7.0E-11
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 171 529 7.0E-11
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 171 529 8.0E-11
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 171 529 8.0E-11
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 171 535 8.0E-11
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 171 529 8.0E-11
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 171 529 8.0E-11
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 171 535 9.0E-11
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 164 529 9.0E-11
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 171 529 9.0E-11
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 171 535 9.0E-11
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 171 535 1.0E-10
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 171 529 1.0E-10
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 171 535 1.0E-10
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 164 529 1.0E-10
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 171 529 1.0E-10
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 171 535 1.0E-10
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 171 535 1.0E-10
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 171 535 1.0E-10
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 171 529 1.0E-10
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 178 529 4.0E-10
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 171 525 1.0E-09
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 414 544 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|082100
MVEQEQRIHFQGIQDSPVKMWEALEAVHRQKRAGMRFNAYDDLFSIRKLEEESLQSLINRVESSKRKIKELRPSS
FTLEQLDDELASMALIRALPDAFSGFTSSLLLMDKLDKTTVHQAFVTEDLQRKKRAQDSSTSSHALAARSGSQNT
LKTCDFCGREGHKFSECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTHAPKKAQRVTEFAGNASTPHP
SPSPSPSTPLQLDADFHWLADTGATSHMTPHRHWFKSYTSHKIPIRLADNSIVYSLGVGSVVFEPVVNGKVVRAV
ELTRVLHVPALRSNLLSCLYLARNKGFNITISSHSIDFKHKGTSLFTATIHSNNSAELNGSTVTSETAFSVSTLP
VDLSLWHRCFIHHNFADVKTMISKELVTGLKLESNSPPDAICEPCLAGKMHSLPFPSSLNHNRSPLELVHSDLHG
PLPVASHSGYKYWITFIDDATRFRAVYLLKAKSEAFEAFIVYKSWAETQLGVKLRALQDDKGGEYMSKAFISFTE
LAGIERRHSTRNRPQQNGLFFFCNQCNIFQYYSYIGCHDTFPRLYVLLPVYRGPGQQYSI*
Coding >AgabiH97|082100
ATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATCCGAAAACTCGAG
GAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGCGTTTTCCGGC
TTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTCACAGAGGACTTA
CAACGCAAAAAACGCGCTCAGGACTCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACG
TTGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGC
TCTAGCTCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCC
TCACCTTCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCCATTGTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTT
GAGTTGACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAG
GGCTTCAATATCACCATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATC
CATTCCAACAACTCTGCTGAGCTCAACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCG
GTTGACCTCTCGCTATGGCATCGTTGCTTTATTCATCACAATTTCGCTGATGTGAAGACTATGATCAGTAAGGAA
CTAGTCACTGGCTTGAAACTCGAGTCAAATTCACCTCCTGATGCTATCTGTGAGCCCTGCCTTGCTGGCAAGATG
CATTCCCTTCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTCGAGCTAGTGCATTCAGATCTTCACGGA
CCGCTCCCAGTTGCTTCACACTCAGGCTACAAGTACTGGATCACCTTCATTGACGACGCGACGCGTTTCCGGGCA
GTCTATCTGCTCAAAGCTAAGTCGGAGGCATTTGAAGCCTTCATAGTCTACAAATCTTGGGCCGAGACTCAACTC
GGAGTCAAACTGCGAGCACTACAGGATGATAAGGGCGGCGAGTATATGTCTAAGGCTTTCATAAGCTTTACTGAG
CTTGCTGGCATCGAGAGACGTCACTCAACTCGAAATCGGCCTCAGCAGAATGGTCTTTTTTTTTTTTGTAATCAA
TGTAATATATTTCAATACTACTCATACATCGGGTGTCATGACACGTTCCCGCGGCTTTACGTACTCCTGCCAGTT
TACAGAGGCCCAGGACAACAGTATTCTATCTAA
Transcript >AgabiH97|082100
ATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATCCGAAAACTCGAG
GAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGCGTTTTCCGGC
TTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTCACAGAGGACTTA
CAACGCAAAAAACGCGCTCAGGACTCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACG
TTGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGC
TCTAGCTCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCC
TCACCTTCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCCATTGTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTT
GAGTTGACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAG
GGCTTCAATATCACCATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATC
CATTCCAACAACTCTGCTGAGCTCAACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCG
GTTGACCTCTCGCTATGGCATCGTTGCTTTATTCATCACAATTTCGCTGATGTGAAGACTATGATCAGTAAGGAA
CTAGTCACTGGCTTGAAACTCGAGTCAAATTCACCTCCTGATGCTATCTGTGAGCCCTGCCTTGCTGGCAAGATG
CATTCCCTTCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTCGAGCTAGTGCATTCAGATCTTCACGGA
CCGCTCCCAGTTGCTTCACACTCAGGCTACAAGTACTGGATCACCTTCATTGACGACGCGACGCGTTTCCGGGCA
GTCTATCTGCTCAAAGCTAAGTCGGAGGCATTTGAAGCCTTCATAGTCTACAAATCTTGGGCCGAGACTCAACTC
GGAGTCAAACTGCGAGCACTACAGGATGATAAGGGCGGCGAGTATATGTCTAAGGCTTTCATAAGCTTTACTGAG
CTTGCTGGCATCGAGAGACGTCACTCAACTCGAAATCGGCCTCAGCAGAATGGTCTTTTTTTTTTTTGTAATCAA
TGTAATATATTTCAATACTACTCATACATCGGGTGTCATGACACGTTCCCGCGGCTTTACGTACTCCTGCCAGTT
TACAGAGGCCCAGGACAACAGTATTCTATCTAA
Gene >AgabiH97|082100
ATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGGGAGGCTCTAGAG
GCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATCCGAAAACTCGAG
GAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCCCCTCTTCC
TTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGACGCGTTTTCCGGC
TTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTCACAGAGGACTTA
CAACGCAAAAAACGCGCTCAGGACTCCTCTACCTCCTCCCATGCACTAGCTGCTCGCTCTGGCTCTCAAAACACG
TTGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTTAGTGAATGCAAAACCTTCGAGAGAGCGAAGTCC
CGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGTCCGGGAGC
TCTAGCTCGACTCACGCTCCTAAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCCCTCATCCC
TCACCTTCTCCCTCGCCTTCTACACCTCTCCAGCTCGATGCTGACTTCCACTGGCTTGCAGATACAGGGGCCACT
TCTCATATGACCCCTCACCGGCACTGGTTCAAGTCATATACCAGTCACAAAATCCCCATCCGACTAGCTGACAAC
TCCATTGTCTATTCTTTGGGGGTGGGATCTGTAGTCTTTGAACCAGTTGTGAATGGAAAGGTGGTCAGAGCAGTT
GAGTTGACTAGAGTTCTGCATGTCCCGGCTCTCCGGAGCAATCTGTTATCATGTCTATACCTTGCCCGTAACAAG
GGCTTCAATATCACCATCTCCTCTCACTCCATTGACTTCAAACATAAGGGCACATCGCTTTTCACGGCCACTATC
CATTCCAACAACTCTGCTGAGCTCAACGGCTCAACTGTGACTTCTGAGACTGCTTTCTCTGTCTCTACCCTCCCG
GTTGACCTCTCGCTATGGCATCGTTGCTTTATTCATCACAATTTCGCTGATGTGAAGACTATGATCAGTAAGGAA
CTAGTCACTGGCTTGAAACTCGAGTCAAATTCACCTCCTGATGCTATCTGTGAGCCCTGCCTTGCTGGCAAGATG
CATTCCCTTCCTTTTCCCTCCTCCTTGAATCACAATCGCTCTCCTCTCGAGCTAGTGCATTCAGATCTTCACGGA
CCGCTCCCAGTTGCTTCACACTCAGGCTACAAGTACTGGATCACCTTCATTGACGACGCGACGCGTTTCCGGGCA
GTCTATCTGCTCAAAGCTAAGTCGGAGGCATTTGAAGCCTTCATAGTCTACAAATCTTGGGCCGAGACTCAACTC
GGAGTCAAACTGCGAGCACTACAGGATGATAAGGGCGGCGAGTATATGTCTAAGGCTTTCATAAGCTTTACTGAG
CTTGCTGGCATCGAGAGACGTCACTCAACTCGAAATCGGCCTCAGCAGAATGGTCTTTTTTTTTTTTGTAATCAA
TGTAATATATTTCAATACTACTCATACATCGGGTGTCATGACACGTTCCCGCGGCTTTACGTACTCCTGCCAGTT
TACAGAGGCCCAGGACAACAGTATTCTATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail