Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081980
Gene name
Locationscaffold_5:961357..962095
Strand+
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.6E-11 27 158

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081980
MVWRDGGMAESLWALETCLWQAEGGWLYLMVEQEQRIHFQGIQDSPVKMWEALEAVHRQKRAGMRFNAYDDLFSI
RKLEEESLQSLINRVESSKRKIKELRPSSFTLEQLDDELASMALIRALPDAFSGFTSSLLLMDKLDKTTVHQAFV
TEDLQRKKRAQDSSTTEYISILIHTSGITTRSRGFLPSPVYRGPELQYSIYKTVSSATRSSAIEKEKKKKKTDQD
IDTYVRGPGIKPSSQAIHPT*
Coding >AgabiH97|081980
ATGGTCTGGAGAGATGGAGGCATGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCTGGCAGGCAGAAGGCGGC
TGGCTGTACCTTATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGG
GAGGCTCTAGAGGCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATC
CGAAAACTCGAGGAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTC
CGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGAC
GCGTTTTCCGGCTTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTT
ACAGAGGACTTACAACGCAAAAAACGCGCTCAGGACTCCTCTACAACAGAGTATATTTCAATACTAATTCATACA
TCGGGTATCACGACACGTTCCCGCGGCTTTCTACCCTCGCCAGTTTACAGAGGCCCAGAACTACAGTATTCTATC
TACAAAACCGTATCCAGCGCGACGAGGTCAAGCGCTATCGAGAAAGAGAAAAAGAAAAAGAAAACAGATCAAGAC
ATTGATACATACGTAAGAGGCCCCGGGATAAAACCAAGCAGTCAGGCAATACATCCTACATAA
Transcript >AgabiH97|081980
ATGGTCTGGAGAGATGGAGGCATGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCTGGCAGGCAGAAGGCGGC
TGGCTGTACCTTATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGG
GAGGCTCTAGAGGCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATC
CGAAAACTCGAGGAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTC
CGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGAC
GCGTTTTCCGGCTTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTT
ACAGAGGACTTACAACGCAAAAAACGCGCTCAGGACTCCTCTACAACAGAGTATATTTCAATACTAATTCATACA
TCGGGTATCACGACACGTTCCCGCGGCTTTCTACCCTCGCCAGTTTACAGAGGCCCAGAACTACAGTATTCTATC
TACAAAACCGTATCCAGCGCGACGAGGTCAAGCGCTATCGAGAAAGAGAAAAAGAAAAAGAAAACAGATCAAGAC
ATTGATACATACGTAAGAGGCCCCGGGATAAAACCAAGCAGTCAGGCAATACATCCTACATAA
Gene >AgabiH97|081980
ATGGTCTGGAGAGATGGAGGCATGGCTGAGAGCCTCTGGGCTCTGGAGACTTGTCTCTGGCAGGCAGAAGGCGGC
TGGCTGTACCTTATGGTGGAGCAGGAGCAGAGAATCCACTTCCAGGGCATCCAGGACAGTCCTGTGAAGATGTGG
GAGGCTCTAGAGGCTGTACATCGTCAGAAGAGGGCTGGAATGCGATTCAATGCCTATGATGACCTCTTTTCCATC
CGAAAACTCGAGGAGGAGTCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTC
CGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATCAGAGCGCTCCCGGAC
GCGTTTTCCGGCTTCACATCGTCCCTACTGCTTATGGACAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTT
ACAGAGGACTTACAACGCAAAAAACGCGCTCAGGACTCCTCTACAACAGAGTATATTTCAATACTAATTCATACA
TCGGGTATCACGACACGTTCCCGCGGCTTTCTACCCTCGCCAGTTTACAGAGGCCCAGAACTACAGTATTCTATC
TACAAAACCGTATCCAGCGCGACGAGGTCAAGCGCTATCGAGAAAGAGAAAAAGAAAAAGAAAACAGATCAAGAC
ATTGATACATACGTAAGAGGCCCCGGGATAAAACCAAGCAGTCAGGCAATACATCCTACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail