Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081830
Gene name
Locationscaffold_5:932296..934814
Strand-
Gene length (bp)2518
Transcript length (bp)2463
Coding sequence length (bp)2463
Protein length (aa) 821

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 3.3E-08 466 551
PF13650 Asp_protease_2 Aspartyl protease 2.0E-07 466 549
PF08284 RVP_2 Retroviral aspartyl protease 8.7E-06 469 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 698 816 2.0E-16
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 693 816 5.0E-16
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 653 816 2.0E-15
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 653 816 2.0E-15
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 653 816 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 698 816 2.0E-16
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 693 816 5.0E-16
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 653 816 2.0E-15
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 653 816 2.0E-15
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 653 816 2.0E-15
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 653 816 2.0E-15
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 653 816 2.0E-15
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 653 816 2.0E-15
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 653 816 2.0E-15
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 653 816 2.0E-15
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 653 816 2.0E-15
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 653 816 2.0E-15
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 653 816 2.0E-15
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 634 813 6.0E-15
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 698 816 1.0E-14
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 698 816 2.0E-14
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 680 816 8.0E-13
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 624 813 2.0E-12
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 674 816 6.0E-12
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 674 816 6.0E-12
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 674 816 7.0E-12
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 674 816 9.0E-12
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 643 814 2.0E-11
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 674 816 1.0E-10
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 719 816 1.0E-09
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 721 816 5.0E-09
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 684 816 4.0E-08
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 749 816 4.0E-08
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 643 816 3.0E-07
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 705 816 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081830
MTAVKLLSGIALQPGHLPSLPNVPSTKIDAIFCNDLDISFCSHFNGLSKPVPDTAWVSRGMSCFSTCPPIYNWIQ
SLRAELMDGTWPEFMTALRKCFLQPDWHQTLCMDMICCLMKESDNFVVWIEELISLNNCLQDTPSHFDDESFITV
IGPNVFGDLYRKGCKRNFYDTRIYTAIAAWQAEMIKLEEIILPQLDPLPLLRLVPLRLSFPAWSHPYYATPPQGD
SRPVSVTTRSLFTHGSGIPAPPKLTMEERCILDDNKGCCKCRHINPGHDFGQCQNDVPSGDGYKPVVYKLLLPNL
YSAHSSQQNSSTRNNSATSTLTSTTSSTAAKCPTPSDNTDRNKHFKPMNAVQEESGDVAAFVSEIDSSDDSFVIP
SFISPSRKPLSRPSATLRHSSPRGRISDVVTGAQHSSFHIPPIPDFGNVTEPSFGHWDTVRDVSVVSTVNAKQLL
WPCALTSTSSSDAHADVHALIDTGASVILIRDTLVNDLNLPLSPLEKPISIRTATNTCKDLRFSVNILLSSRDRT
YTAKPFRAIVSDTLSNEIILGMPFLQANSIVVDTSTGSVIDKVNDFCLFSIQSSPIPGHQHKKIPLPHKRLMTTR
KYCNKLLTDLKHRLAVVCWSLDKHYSVVQSSAEPLVAQIVHRIESIELSSSLQAECDNIISEFESVFANIPHAND
LPQDVLVEIKLKDANFSIQTRTYTCPRKYRQAWRTLIQQHLDAGRIRQSSAPQASPAFIIPKSDSTALPRWVNNY
QQLNKNTIPDKYPLPRMDDILADCAKGTVWGTMDMTNAFFQTRMKPADIPLTAVSTPFGLYEWCVMLNVE*
Coding >AgabiH97|081830
ATGACCGCAGTTAAACTCCTTTCCGGCATCGCCCTTCAACCCGGTCATTTGCCTTCTCTTCCAAATGTACCTTCG
ACTAAAATCGATGCTATCTTCTGCAATGACCTCGATATTTCCTTTTGCAGCCATTTCAATGGGTTGTCCAAACCT
GTGCCCGACACGGCCTGGGTTTCGCGGGGGATGAGCTGTTTCTCGACTTGTCCTCCCATCTATAACTGGATTCAG
AGTCTTCGTGCGGAACTCATGGATGGAACCTGGCCTGAATTCATGACTGCCCTTCGTAAATGTTTTCTTCAGCCT
GATTGGCATCAAACCTTGTGTATGGACATGATTTGTTGTCTCATGAAAGAATCTGACAACTTCGTTGTTTGGATT
GAGGAATTGATCTCTCTCAATAATTGTCTTCAAGACACTCCCTCTCATTTCGATGATGAGTCTTTTATCACTGTC
ATTGGTCCTAACGTCTTTGGTGATCTTTATAGAAAAGGTTGCAAAAGAAATTTCTACGACACCAGGATATACACC
GCCATAGCTGCTTGGCAGGCTGAGATGATTAAGCTTGAGGAGATCATTCTTCCACAACTCGATCCTCTTCCACTC
CTGCGACTCGTTCCACTTCGACTGTCGTTCCCTGCTTGGTCTCATCCATATTACGCTACTCCACCTCAAGGAGAT
TCTCGACCCGTCTCTGTGACTACTCGTTCTCTCTTCACACATGGTTCCGGCATACCTGCCCCGCCTAAACTCACG
ATGGAGGAGCGTTGCATTCTTGATGATAACAAGGGGTGTTGCAAGTGTCGCCATATTAACCCTGGTCATGACTTT
GGACAGTGTCAGAATGATGTTCCATCTGGAGATGGTTATAAACCGGTGGTGTACAAATTGTTACTTCCTAATTTG
TACTCTGCACACTCTTCCCAGCAGAATTCATCTACCCGAAACAATTCCGCTACATCCACATTGACATCCACTACA
TCTTCTACTGCCGCTAAGTGTCCCACGCCGTCGGACAATACGGATAGAAACAAACACTTCAAACCTATGAATGCG
GTTCAGGAGGAATCTGGTGATGTTGCTGCCTTCGTCTCAGAGATTGACAGTTCGGATGATTCTTTTGTCATTCCT
TCTTTCATTTCTCCGTCTCGCAAGCCTTTGTCTCGTCCATCTGCAACCCTCCGTCATTCTTCGCCTCGTGGACGT
ATCTCCGACGTCGTCACTGGTGCACAACACTCTTCTTTCCATATCCCACCCATCCCAGACTTTGGTAACGTCACT
GAACCATCGTTTGGTCATTGGGATACCGTTAGAGACGTCTCCGTTGTGAGTACTGTCAATGCTAAACAATTGCTT
TGGCCTTGTGCACTGACGAGTACTTCGTCTAGCGACGCCCATGCAGACGTTCATGCTCTGATTGATACTGGCGCT
TCTGTCATCTTGATCCGTGACACCCTTGTCAATGACCTAAATTTACCTCTCTCTCCCCTTGAGAAACCTATATCA
ATTCGTACCGCCACAAATACTTGTAAAGACCTTCGTTTTTCTGTAAACATCCTCCTATCCTCTCGTGATCGTACA
TACACAGCGAAACCTTTCCGCGCTATTGTTTCAGACACTCTTTCAAATGAAATTATTCTTGGAATGCCTTTCCTT
CAGGCAAATTCTATTGTGGTTGATACATCCACTGGTTCCGTTATTGATAAGGTCAACGATTTTTGCCTTTTTTCT
ATCCAATCGTCTCCCATTCCTGGTCATCAACATAAAAAAATTCCTTTGCCTCATAAACGTTTAATGACTACACGT
AAATACTGCAACAAATTATTGACTGATCTCAAGCACCGACTTGCGGTTGTCTGTTGGTCTTTGGATAAACACTAC
TCTGTTGTTCAATCTTCTGCTGAACCCCTTGTTGCTCAAATTGTTCATCGTATTGAGAGTATTGAACTTTCGTCA
TCCCTACAAGCTGAATGTGACAACATTATTTCCGAATTTGAGTCTGTTTTTGCAAACATACCTCATGCAAATGAC
CTTCCACAGGACGTGTTAGTGGAAATCAAATTAAAAGATGCGAATTTCTCCATACAAACGCGTACTTACACTTGC
CCTCGTAAATATCGTCAAGCTTGGCGCACTCTCATCCAGCAACATTTGGATGCTGGGCGTATAAGACAGTCCTCT
GCTCCACAAGCTTCTCCCGCATTTATTATTCCCAAATCTGACTCCACCGCGCTACCACGTTGGGTTAATAATTAC
CAACAACTCAATAAAAACACTATTCCTGATAAATATCCCTTACCCCGTATGGATGACATTCTTGCTGATTGTGCA
AAAGGAACGGTTTGGGGCACTATGGACATGACCAACGCTTTCTTTCAAACAAGAATGAAACCTGCAGATATTCCC
CTCACCGCTGTTTCCACACCTTTTGGTCTGTATGAGTGGTGTGTCATGTTAAACGTAGAATGA
Transcript >AgabiH97|081830
ATGACCGCAGTTAAACTCCTTTCCGGCATCGCCCTTCAACCCGGTCATTTGCCTTCTCTTCCAAATGTACCTTCG
ACTAAAATCGATGCTATCTTCTGCAATGACCTCGATATTTCCTTTTGCAGCCATTTCAATGGGTTGTCCAAACCT
GTGCCCGACACGGCCTGGGTTTCGCGGGGGATGAGCTGTTTCTCGACTTGTCCTCCCATCTATAACTGGATTCAG
AGTCTTCGTGCGGAACTCATGGATGGAACCTGGCCTGAATTCATGACTGCCCTTCGTAAATGTTTTCTTCAGCCT
GATTGGCATCAAACCTTGTGTATGGACATGATTTGTTGTCTCATGAAAGAATCTGACAACTTCGTTGTTTGGATT
GAGGAATTGATCTCTCTCAATAATTGTCTTCAAGACACTCCCTCTCATTTCGATGATGAGTCTTTTATCACTGTC
ATTGGTCCTAACGTCTTTGGTGATCTTTATAGAAAAGGTTGCAAAAGAAATTTCTACGACACCAGGATATACACC
GCCATAGCTGCTTGGCAGGCTGAGATGATTAAGCTTGAGGAGATCATTCTTCCACAACTCGATCCTCTTCCACTC
CTGCGACTCGTTCCACTTCGACTGTCGTTCCCTGCTTGGTCTCATCCATATTACGCTACTCCACCTCAAGGAGAT
TCTCGACCCGTCTCTGTGACTACTCGTTCTCTCTTCACACATGGTTCCGGCATACCTGCCCCGCCTAAACTCACG
ATGGAGGAGCGTTGCATTCTTGATGATAACAAGGGGTGTTGCAAGTGTCGCCATATTAACCCTGGTCATGACTTT
GGACAGTGTCAGAATGATGTTCCATCTGGAGATGGTTATAAACCGGTGGTGTACAAATTGTTACTTCCTAATTTG
TACTCTGCACACTCTTCCCAGCAGAATTCATCTACCCGAAACAATTCCGCTACATCCACATTGACATCCACTACA
TCTTCTACTGCCGCTAAGTGTCCCACGCCGTCGGACAATACGGATAGAAACAAACACTTCAAACCTATGAATGCG
GTTCAGGAGGAATCTGGTGATGTTGCTGCCTTCGTCTCAGAGATTGACAGTTCGGATGATTCTTTTGTCATTCCT
TCTTTCATTTCTCCGTCTCGCAAGCCTTTGTCTCGTCCATCTGCAACCCTCCGTCATTCTTCGCCTCGTGGACGT
ATCTCCGACGTCGTCACTGGTGCACAACACTCTTCTTTCCATATCCCACCCATCCCAGACTTTGGTAACGTCACT
GAACCATCGTTTGGTCATTGGGATACCGTTAGAGACGTCTCCGTTGTGAGTACTGTCAATGCTAAACAATTGCTT
TGGCCTTGTGCACTGACGAGTACTTCGTCTAGCGACGCCCATGCAGACGTTCATGCTCTGATTGATACTGGCGCT
TCTGTCATCTTGATCCGTGACACCCTTGTCAATGACCTAAATTTACCTCTCTCTCCCCTTGAGAAACCTATATCA
ATTCGTACCGCCACAAATACTTGTAAAGACCTTCGTTTTTCTGTAAACATCCTCCTATCCTCTCGTGATCGTACA
TACACAGCGAAACCTTTCCGCGCTATTGTTTCAGACACTCTTTCAAATGAAATTATTCTTGGAATGCCTTTCCTT
CAGGCAAATTCTATTGTGGTTGATACATCCACTGGTTCCGTTATTGATAAGGTCAACGATTTTTGCCTTTTTTCT
ATCCAATCGTCTCCCATTCCTGGTCATCAACATAAAAAAATTCCTTTGCCTCATAAACGTTTAATGACTACACGT
AAATACTGCAACAAATTATTGACTGATCTCAAGCACCGACTTGCGGTTGTCTGTTGGTCTTTGGATAAACACTAC
TCTGTTGTTCAATCTTCTGCTGAACCCCTTGTTGCTCAAATTGTTCATCGTATTGAGAGTATTGAACTTTCGTCA
TCCCTACAAGCTGAATGTGACAACATTATTTCCGAATTTGAGTCTGTTTTTGCAAACATACCTCATGCAAATGAC
CTTCCACAGGACGTGTTAGTGGAAATCAAATTAAAAGATGCGAATTTCTCCATACAAACGCGTACTTACACTTGC
CCTCGTAAATATCGTCAAGCTTGGCGCACTCTCATCCAGCAACATTTGGATGCTGGGCGTATAAGACAGTCCTCT
GCTCCACAAGCTTCTCCCGCATTTATTATTCCCAAATCTGACTCCACCGCGCTACCACGTTGGGTTAATAATTAC
CAACAACTCAATAAAAACACTATTCCTGATAAATATCCCTTACCCCGTATGGATGACATTCTTGCTGATTGTGCA
AAAGGAACGGTTTGGGGCACTATGGACATGACCAACGCTTTCTTTCAAACAAGAATGAAACCTGCAGATATTCCC
CTCACCGCTGTTTCCACACCTTTTGGTCTGTATGAGTGGTGTGTCATGTTAAACGTAGAATGA
Gene >AgabiH97|081830
ATGACCGCAGTTAAACTCCTTTCCGGCATCGCCCTTCAACCCGGTCATTTGCCTTCTCTTCCAAATGTACCTTCG
ACTAAAATCGATGCTATCTTCTGCAATGACCTCGATATTTCCTTTTGCAGCCATTTCAATGGGTTGTCCAAACCT
GTGCCCGACACGGCCTGGGTTTCGCGGGGGATGAGCTGTTTCTCGACTTGTCCTCCCATCTATAACTGGATTCAG
AGTCTTCGTGCGGAACTCATGGATGGAACCTGGCCTGAATTCATGACTGCCCTTCGTAAATGTTTTCTTCAGCCT
GATTGGCATCAAACCTTGTGTATGGACATGATTTGTTGTCTCATGAAAGAATCTGACAACTTCGTTGTTTGGATT
GAGGAATTGATCTCTCTCAATAATTGTCTTCAAGACACTCCCTCTCATTTCGATGATGAGTCTTTTATCACTGTC
ATTGGTCCTAACGTCTTTGGTGATCTTTATAGAAAAGGTTGCAAAAGAAATTTCTACGACACCAGGATATACACC
GCCATAGCTGCTTGGCAGGCTGAGATGATTAAGCTTGAGGAGAGTCGCCTTGGAAAAAAGGAAGCTCTCGTGAAA
CAGCTGAAGGATTTTCATGCCAGTCATTCTTCCACAACTCGATCCTCTTCCACTCCTGCGACTCGTTCCACTTCG
ACTGTCGTTCCCTGCTTGGTCTCATCCATATTACGCTACTCCACCTCAAGGAGATTCTCGACCCGTCTCTGTGAC
TACTCGTTCTCTCTTCACACATGGTTCCGGCATACCTGCCCCGCCTAAACTCACGATGGAGGAGCGTTGCATTCT
TGATGATAACAAGGGGTGTTGCAAGTGTCGCCATATTAACCCTGGTCATGACTTTGGACAGTGTCAGAATGATGT
TCCATCTGGAGATGGTTATAAACCGGTGGTGTACAAATTGTTACTTCCTAATTTGTACTCTGCACACTCTTCCCA
GCAGAATTCATCTACCCGAAACAATTCCGCTACATCCACATTGACATCCACTACATCTTCTACTGCCGCTAAGTG
TCCCACGCCGTCGGACAATACGGATAGAAACAAACACTTCAAACCTATGAATGCGGTTCAGGAGGAATCTGGTGA
TGTTGCTGCCTTCGTCTCAGAGATTGACAGTTCGGATGATTCTTTTGTCATTCCTTCTTTCATTTCTCCGTCTCG
CAAGCCTTTGTCTCGTCCATCTGCAACCCTCCGTCATTCTTCGCCTCGTGGACGTATCTCCGACGTCGTCACTGG
TGCACAACACTCTTCTTTCCATATCCCACCCATCCCAGACTTTGGTAACGTCACTGAACCATCGTTTGGTCATTG
GGATACCGTTAGAGACGTCTCCGTTGTGAGTACTGTCAATGCTAAACAATTGCTTTGGCCTTGTGCACTGACGAG
TACTTCGTCTAGCGACGCCCATGCAGACGTTCATGCTCTGATTGATACTGGCGCTTCTGTCATCTTGATCCGTGA
CACCCTTGTCAATGACCTAAATTTACCTCTCTCTCCCCTTGAGAAACCTATATCAATTCGTACCGCCACAAATAC
TTGTAAAGACCTTCGTTTTTCTGTAAACATCCTCCTATCCTCTCGTGATCGTACATACACAGCGAAACCTTTCCG
CGCTATTGTTTCAGACACTCTTTCAAATGAAATTATTCTTGGAATGCCTTTCCTTCAGGCAAATTCTATTGTGGT
TGATACATCCACTGGTTCCGTTATTGATAAGGTCAACGATTTTTGCCTTTTTTCTATCCAATCGTCTCCCATTCC
TGGTCATCAACATAAAAAAATTCCTTTGCCTCATAAACGTTTAATGACTACACGTAAATACTGCAACAAATTATT
GACTGATCTCAAGCACCGACTTGCGGTTGTCTGTTGGTCTTTGGATAAACACTACTCTGTTGTTCAATCTTCTGC
TGAACCCCTTGTTGCTCAAATTGTTCATCGTATTGAGAGTATTGAACTTTCGTCATCCCTACAAGCTGAATGTGA
CAACATTATTTCCGAATTTGAGTCTGTTTTTGCAAACATACCTCATGCAAATGACCTTCCACAGGACGTGTTAGT
GGAAATCAAATTAAAAGATGCGAATTTCTCCATACAAACGCGTACTTACACTTGCCCTCGTAAATATCGTCAAGC
TTGGCGCACTCTCATCCAGCAACATTTGGATGCTGGGCGTATAAGACAGTCCTCTGCTCCACAAGCTTCTCCCGC
ATTTATTATTCCCAAATCTGACTCCACCGCGCTACCACGTTGGGTTAATAATTACCAACAACTCAATAAAAACAC
TATTCCTGATAAATATCCCTTACCCCGTATGGATGACATTCTTGCTGATTGTGCAAAAGGAACGGTTTGGGGCAC
TATGGACATGACCAACGCTTTCTTTCAAACAAGAATGAAACCTGCAGATATTCCCCTCACCGCTGTTTCCACACC
TTTTGGTCTGTATGAGTGGTGTGTCATGTTAAACGTAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail