Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081620
Gene name
Locationscaffold_5:889406..890262
Strand+
Gene length (bp)856
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 1.2E-58 4 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5G1|COX10_GIBZE Protoheme IX farnesyltransferase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX10 PE=3 SV=1 6 258 1.0E-54
sp|Q7S5E7|COX10_NEUCR Protoheme IX farnesyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pft-1 PE=3 SV=2 26 258 7.0E-54
sp|Q9Y7Y4|COX10_SCHPO Protoheme IX farnesyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox10 PE=3 SV=1 1 263 5.0E-53
sp|Q6C0L2|COX10_YARLI Protoheme IX farnesyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX10 PE=3 SV=1 1 237 9.0E-53
sp|Q6CTW6|COX10_KLULA Protoheme IX farnesyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COX10 PE=3 SV=1 5 237 6.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5G1|COX10_GIBZE Protoheme IX farnesyltransferase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX10 PE=3 SV=1 6 258 1.0E-54
sp|Q7S5E7|COX10_NEUCR Protoheme IX farnesyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pft-1 PE=3 SV=2 26 258 7.0E-54
sp|Q9Y7Y4|COX10_SCHPO Protoheme IX farnesyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox10 PE=3 SV=1 1 263 5.0E-53
sp|Q6C0L2|COX10_YARLI Protoheme IX farnesyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX10 PE=3 SV=1 1 237 9.0E-53
sp|Q6CTW6|COX10_KLULA Protoheme IX farnesyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COX10 PE=3 SV=1 5 237 6.0E-52
sp|P21592|COX10_YEAST Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX10 PE=3 SV=1 5 237 9.0E-52
sp|Q8CFY5|COX10_MOUSE Protoheme IX farnesyltransferase, mitochondrial OS=Mus musculus GN=Cox10 PE=2 SV=1 2 263 1.0E-50
sp|Q75F43|COX10_ASHGO Protoheme IX farnesyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COX10 PE=3 SV=1 5 241 4.0E-50
sp|Q12887|COX10_HUMAN Protoheme IX farnesyltransferase, mitochondrial OS=Homo sapiens GN=COX10 PE=1 SV=3 2 261 8.0E-50
sp|P0C150|COX10_MAGO7 Protoheme IX farnesyltransferase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=COX10 PE=3 SV=1 26 256 1.0E-49
sp|Q5R460|COX10_PONAB Protoheme IX farnesyltransferase, mitochondrial OS=Pongo abelii GN=COX10 PE=2 SV=1 2 261 2.0E-49
sp|Q6FUG4|COX10_CANGA Protoheme IX farnesyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COX10 PE=3 SV=1 5 237 3.0E-49
sp|Q6BKW6|COX10_DEBHA Protoheme IX farnesyltransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COX10 PE=3 SV=2 5 252 1.0E-48
sp|Q4WP81|COX10_ASPFU Protoheme IX farnesyltransferase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cox10 PE=3 SV=1 5 256 8.0E-47
sp|Q5BCK8|COX10_EMENI Protoheme IX farnesyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox10 PE=3 SV=1 6 256 2.0E-45
sp|O64886|COX10_ARATH Protoheme IX farnesyltransferase, mitochondrial OS=Arabidopsis thaliana GN=COX10 PE=2 SV=4 12 263 3.0E-38
sp|A7H8V9|COXX_ANADF Protoheme IX farnesyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ctaB PE=3 SV=1 29 225 2.0E-27
sp|Q2S012|COXX_SALRD Protoheme IX farnesyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=ctaB PE=3 SV=2 16 242 5.0E-26
sp|A9GEU3|COXX_SORC5 Protoheme IX farnesyltransferase OS=Sorangium cellulosum (strain So ce56) GN=ctaB PE=3 SV=2 14 211 2.0E-25
sp|Q54JB3|COX10_DICDI Probable protoheme IX farnesyltransferase, mitochondrial OS=Dictyostelium discoideum GN=cox10 PE=3 SV=1 15 245 6.0E-25
sp|Q1IPI1|COXX_KORVE Protoheme IX farnesyltransferase OS=Koribacter versatilis (strain Ellin345) GN=ctaB PE=3 SV=1 3 219 7.0E-25
sp|Q0VN94|CYOE_ALCBS Protoheme IX farnesyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cyoE PE=3 SV=1 6 248 3.0E-24
sp|Q79EF2|COXX_SYNY3 Protoheme IX farnesyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ctaB PE=3 SV=1 27 258 4.0E-24
sp|Q48AB7|CYOE_COLP3 Protoheme IX farnesyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cyoE PE=3 SV=2 16 260 7.0E-24
sp|Q2IPE5|COXX_ANADE Protoheme IX farnesyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ctaB PE=3 SV=2 19 237 1.0E-23
sp|Q2SQU8|CYOE_HAHCH Protoheme IX farnesyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=cyoE PE=3 SV=1 34 260 4.0E-23
sp|Q8DHQ2|COXX_THEEB Protoheme IX farnesyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=ctaB PE=3 SV=2 14 261 4.0E-23
sp|B1XKB3|COXX_SYNP2 Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctaB PE=3 SV=1 27 258 6.0E-23
sp|A8KYS6|COXX_FRASN Protoheme IX farnesyltransferase OS=Frankia sp. (strain EAN1pec) GN=ctaB PE=3 SV=1 9 201 6.0E-23
sp|A6H1E4|COXX_FLAPJ Protoheme IX farnesyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ctaB PE=3 SV=1 12 263 2.0E-22
sp|Q9XAC2|COXX_STRCO Protoheme IX farnesyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ctaB PE=3 SV=2 13 261 2.0E-22
sp|Q114N4|COXX_TRIEI Protoheme IX farnesyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=ctaB PE=3 SV=1 15 258 3.0E-22
sp|Q01YC2|COXX_SOLUE Protoheme IX farnesyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=ctaB PE=3 SV=1 16 200 5.0E-22
sp|Q829U3|COXX_STRAW Protoheme IX farnesyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ctaB PE=3 SV=2 12 261 5.0E-22
sp|Q39Z26|COXX_GEOMG Protoheme IX farnesyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ctaB PE=3 SV=1 1 192 6.0E-22
sp|Q21PS1|CYOE_SACD2 Protoheme IX farnesyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cyoE PE=3 SV=1 13 209 9.0E-22
sp|Q7UJF4|COXX_RHOBA Protoheme IX farnesyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ctaB PE=3 SV=2 21 261 1.0E-21
sp|B7KHX2|COXX_CYAP7 Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=ctaB PE=3 SV=1 26 258 1.0E-21
sp|Q3IJQ0|CYOE2_PSEHT Protoheme IX farnesyltransferase 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cyoE2 PE=3 SV=1 3 228 1.0E-21
sp|A8FCU6|COXX_BACP2 Protoheme IX farnesyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=ctaB PE=3 SV=1 13 218 2.0E-21
sp|A4YC13|CYOE1_SHEPC Protoheme IX farnesyltransferase 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cyoE1 PE=3 SV=1 9 250 2.0E-21
sp|A1RE84|CYOE2_SHESW Protoheme IX farnesyltransferase 2 OS=Shewanella sp. (strain W3-18-1) GN=cyoE2 PE=3 SV=1 9 250 2.0E-21
sp|B0TNS4|CYOE_SHEHH Protoheme IX farnesyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cyoE PE=3 SV=1 9 250 3.0E-21
sp|B7K336|COXX_CYAP8 Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=ctaB PE=3 SV=1 16 223 3.0E-21
sp|Q2JCG7|COXX_FRASC Protoheme IX farnesyltransferase OS=Frankia sp. (strain CcI3) GN=ctaB PE=3 SV=1 9 198 3.0E-21
sp|A0AKG3|COXX_LISW6 Protoheme IX farnesyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ctaB PE=3 SV=1 13 219 3.0E-21
sp|Q0RH20|COXX_FRAAA Protoheme IX farnesyltransferase OS=Frankia alni (strain ACN14a) GN=ctaB PE=3 SV=2 9 198 4.0E-21
sp|Q5X7X6|CYOE_LEGPA Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Paris) GN=cyoE PE=3 SV=1 19 198 7.0E-21
sp|A0LXT1|COXX_GRAFK Protoheme IX farnesyltransferase OS=Gramella forsetii (strain KT0803) GN=ctaB PE=3 SV=1 20 238 7.0E-21
sp|B8HMH3|COXX_CYAP4 Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ctaB PE=3 SV=1 14 206 7.0E-21
sp|Q8E8P7|CYOE_SHEON Protoheme IX farnesyltransferase OS=Shewanella oneidensis (strain MR-1) GN=cyoE PE=3 SV=1 9 263 8.0E-21
sp|A1SY55|CYOE_PSYIN Protoheme IX farnesyltransferase OS=Psychromonas ingrahamii (strain 37) GN=cyoE PE=3 SV=1 1 248 9.0E-21
sp|A4FBP2|COXX2_SACEN Protoheme IX farnesyltransferase 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ctaB2 PE=3 SV=1 15 198 1.0E-20
sp|Q3MFT6|COXX_ANAVT Protoheme IX farnesyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ctaB PE=3 SV=1 15 258 1.0E-20
sp|B8DH72|COXX_LISMH Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ctaB PE=3 SV=1 13 219 1.0E-20
sp|Q71XV7|COXX_LISMF Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ctaB PE=3 SV=1 13 219 1.0E-20
sp|C1KX10|COXX_LISMC Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ctaB PE=3 SV=1 13 219 1.0E-20
sp|Q089I2|CYOE1_SHEFN Protoheme IX farnesyltransferase 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=cyoE1 PE=3 SV=1 13 252 1.0E-20
sp|Q089F2|CYOE2_SHEFN Protoheme IX farnesyltransferase 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=cyoE2 PE=3 SV=1 1 228 2.0E-20
sp|Q929W0|COXX_LISIN Protoheme IX farnesyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ctaB PE=3 SV=1 13 219 2.0E-20
sp|Q8Y5K3|COXX_LISMO Protoheme IX farnesyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ctaB PE=3 SV=1 13 219 2.0E-20
sp|Q8YYA3|COXX_NOSS1 Protoheme IX farnesyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ctaB PE=3 SV=1 15 258 2.0E-20
sp|A0LTZ0|COXX_ACIC1 Protoheme IX farnesyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ctaB PE=3 SV=1 31 198 3.0E-20
sp|Q5R0Y6|CYOE_IDILO Protoheme IX farnesyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cyoE PE=3 SV=1 12 260 3.0E-20
sp|A4VS42|CYOE_PSEU5 Protoheme IX farnesyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=cyoE PE=3 SV=1 15 218 3.0E-20
sp|Q5ZYG0|CYOE_LEGPH Protoheme IX farnesyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cyoE PE=3 SV=1 19 198 4.0E-20
sp|A5IHI2|CYOE_LEGPC Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Corby) GN=cyoE PE=3 SV=1 19 198 4.0E-20
sp|Q5WZC7|CYOE_LEGPL Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Lens) GN=cyoE PE=3 SV=1 19 198 4.0E-20
sp|Q2GJ17|COXX_ANAPZ Protoheme IX farnesyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=ctaB PE=3 SV=1 17 257 4.0E-20
sp|B1W108|COXX_STRGG Protoheme IX farnesyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ctaB PE=3 SV=2 15 261 4.0E-20
sp|A3CYW8|CYOE_SHEB5 Protoheme IX farnesyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cyoE PE=3 SV=1 9 228 5.0E-20
sp|A9KUX8|CYOE1_SHEB9 Protoheme IX farnesyltransferase 1 OS=Shewanella baltica (strain OS195) GN=cyoE1 PE=3 SV=1 9 228 5.0E-20
sp|A6WU15|CYOE1_SHEB8 Protoheme IX farnesyltransferase 1 OS=Shewanella baltica (strain OS185) GN=cyoE1 PE=3 SV=1 9 228 5.0E-20
sp|A8LW09|COXX_SALAI Protoheme IX farnesyltransferase OS=Salinispora arenicola (strain CNS-205) GN=ctaB PE=3 SV=1 21 248 5.0E-20
sp|B0C0A5|COXX_ACAM1 Protoheme IX farnesyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=ctaB PE=3 SV=1 14 206 5.0E-20
sp|Q0HDK5|CYOE1_SHESM Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain MR-4) GN=cyoE1 PE=3 SV=1 9 263 8.0E-20
sp|O31652|COXX1_BACSU Protoheme IX farnesyltransferase 1 OS=Bacillus subtilis (strain 168) GN=ctaB1 PE=1 SV=3 16 226 1.0E-19
sp|Q0HPV6|CYOE1_SHESR Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain MR-7) GN=cyoE1 PE=3 SV=1 9 263 1.0E-19
sp|A0L2E7|CYOE1_SHESA Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain ANA-3) GN=cyoE1 PE=3 SV=1 9 263 1.0E-19
sp|Q6LVR2|CYOE_PHOPR Protoheme IX farnesyltransferase OS=Photobacterium profundum GN=cyoE PE=3 SV=2 21 242 1.0E-19
sp|Q2JNL3|COXX_SYNJB Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ctaB PE=3 SV=1 19 247 2.0E-19
sp|A5FJD0|COXX_FLAJ1 Protoheme IX farnesyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ctaB PE=3 SV=2 15 249 2.0E-19
sp|Q7MDC8|CYOE_VIBVY Protoheme IX farnesyltransferase OS=Vibrio vulnificus (strain YJ016) GN=cyoE PE=3 SV=1 17 260 2.0E-19
sp|Q2JQK9|COXX_SYNJA Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ctaB PE=3 SV=1 19 209 2.0E-19
sp|Q8D6H2|CYOE_VIBVU Protoheme IX farnesyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=cyoE PE=3 SV=1 17 260 3.0E-19
sp|A6WC46|COXX_KINRD Protoheme IX farnesyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=ctaB PE=3 SV=1 9 227 3.0E-19
sp|A8H9S9|CYOE_SHEPA Protoheme IX farnesyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cyoE PE=3 SV=1 9 250 3.0E-19
sp|Q1H1S8|COXX_METFK Protoheme IX farnesyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ctaB PE=3 SV=1 13 229 3.0E-19
sp|Q1GTA5|COXX_SPHAL Protoheme IX farnesyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ctaB PE=3 SV=1 14 205 4.0E-19
sp|B1Y6Q4|COXX_LEPCP Protoheme IX farnesyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ctaB PE=3 SV=1 21 261 5.0E-19
sp|Q15WB8|CYOE1_PSEA6 Protoheme IX farnesyltransferase 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cyoE1 PE=3 SV=1 15 233 7.0E-19
sp|Q0ADH9|COXX_NITEC Protoheme IX farnesyltransferase OS=Nitrosomonas eutropha (strain C91) GN=ctaB PE=3 SV=1 3 261 8.0E-19
sp|Q8K997|CYOE_BUCAP Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cyoE PE=3 SV=1 19 192 1.0E-18
sp|B6EQE1|CYOE_ALISL Protoheme IX farnesyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=cyoE PE=3 SV=1 12 191 1.0E-18
sp|Q15N01|CYOE2_PSEA6 Protoheme IX farnesyltransferase 2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cyoE2 PE=3 SV=1 15 250 1.0E-18
sp|B1ZMT0|COXX_OPITP Protoheme IX farnesyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ctaB PE=3 SV=1 6 202 1.0E-18
sp|A7Z2K2|COXX1_BACMF Protoheme IX farnesyltransferase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ctaB1 PE=3 SV=1 21 225 2.0E-18
sp|Q887G7|CYOE_PSESM Protoheme IX farnesyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cyoE PE=3 SV=1 15 234 2.0E-18
sp|B1KQ72|CYOE2_SHEWM Protoheme IX farnesyltransferase 2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cyoE2 PE=3 SV=2 13 233 2.0E-18
sp|Q2NCF2|COXX_ERYLH Protoheme IX farnesyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=ctaB PE=3 SV=1 14 217 2.0E-18
sp|A8GAQ0|CYOE_SERP5 Protoheme IX farnesyltransferase OS=Serratia proteamaculans (strain 568) GN=cyoE PE=3 SV=1 14 262 2.0E-18
sp|B8GPF3|CYOE_THISH Protoheme IX farnesyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cyoE PE=3 SV=1 1 260 3.0E-18
sp|Q67ML5|COXX_SYMTH Protoheme IX farnesyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ctaB PE=3 SV=1 10 222 3.0E-18
sp|Q12IC7|CYOE_SHEDO Protoheme IX farnesyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cyoE PE=3 SV=1 9 229 3.0E-18
sp|Q48M92|CYOE_PSE14 Protoheme IX farnesyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cyoE PE=3 SV=1 15 234 3.0E-18
sp|Q3J6R6|CYOE_NITOC Protoheme IX farnesyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cyoE PE=3 SV=1 15 198 3.0E-18
sp|A1TWQ8|CYOE_MARHV Protoheme IX farnesyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cyoE PE=3 SV=2 33 259 3.0E-18
sp|A4X9F8|COXX_SALTO Protoheme IX farnesyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ctaB PE=3 SV=2 21 248 4.0E-18
sp|Q1D1K4|COXX_MYXXD Protoheme IX farnesyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=ctaB PE=3 SV=1 17 261 4.0E-18
sp|Q65K13|COXX_BACLD Protoheme IX farnesyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ctaB PE=3 SV=1 13 207 6.0E-18
sp|B2VHR9|CYOE_ERWT9 Protoheme IX farnesyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cyoE PE=3 SV=1 15 134 7.0E-18
sp|Q310M2|COXX_DESAG Protoheme IX farnesyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=ctaB PE=3 SV=1 14 218 9.0E-18
sp|Q4ZXC3|CYOE_PSEU2 Protoheme IX farnesyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cyoE PE=3 SV=1 15 234 9.0E-18
sp|Q3K773|CYOE2_PSEPF Protoheme IX farnesyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=cyoE2 PE=3 SV=1 13 130 1.0E-17
sp|Q3IHM5|CYOE1_PSEHT Protoheme IX farnesyltransferase 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cyoE1 PE=3 SV=1 15 249 1.0E-17
sp|C5BFX0|CYOE_EDWI9 Protoheme IX farnesyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=cyoE PE=3 SV=1 14 237 1.0E-17
sp|Q0BPU7|COXX_GRABC Protoheme IX farnesyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ctaB PE=3 SV=2 14 258 1.0E-17
sp|Q1RFB2|CYOE_ECOUT Protoheme IX farnesyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=cyoE PE=3 SV=2 14 134 1.0E-17
sp|Q0TKL4|CYOE_ECOL5 Protoheme IX farnesyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|A1A897|CYOE_ECOK1 Protoheme IX farnesyltransferase OS=Escherichia coli O1:K1 / APEC GN=cyoE PE=3 SV=2 14 134 1.0E-17
sp|Q325H3|CYOE_SHIBS Protoheme IX farnesyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|B1LJI2|CYOE_ECOSM Protoheme IX farnesyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|P0AEA5|CYOE_ECOLI Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12) GN=cyoE PE=1 SV=1 14 134 1.0E-17
sp|B1J021|CYOE_ECOLC Protoheme IX farnesyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|P0AEA6|CYOE_ECOL6 Protoheme IX farnesyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|A7ZX84|CYOE_ECOHS Protoheme IX farnesyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|B1XFL6|CYOE_ECODH Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|P0AEA7|CYOE_ECO57 Protoheme IX farnesyltransferase OS=Escherichia coli O157:H7 GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|A7ZII5|CYOE_ECO24 Protoheme IX farnesyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cyoE PE=3 SV=1 14 134 1.0E-17
sp|Q3YR13|COXX_EHRCJ Protoheme IX farnesyltransferase OS=Ehrlichia canis (strain Jake) GN=ctaB PE=3 SV=1 20 222 1.0E-17
sp|C5BKU5|CYOE_TERTT Protoheme IX farnesyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cyoE PE=3 SV=1 7 198 2.0E-17
sp|Q6D836|CYOE_PECAS Protoheme IX farnesyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cyoE PE=3 SV=1 14 259 2.0E-17
sp|Q74GM3|COXX_GEOSL Protoheme IX farnesyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ctaB PE=3 SV=1 22 197 2.0E-17
sp|A9KV13|CYOE2_SHEB9 Protoheme IX farnesyltransferase 2 OS=Shewanella baltica (strain OS195) GN=cyoE2 PE=3 SV=1 10 263 2.0E-17
sp|A8AK26|CYOE_CITK8 Protoheme IX farnesyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cyoE PE=3 SV=1 14 134 2.0E-17
sp|Q4K6M1|CYOE2_PSEF5 Protoheme IX farnesyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cyoE2 PE=3 SV=1 13 130 2.0E-17
sp|A9HKH7|COXX_GLUDA Protoheme IX farnesyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ctaB PE=3 SV=1 2 224 2.0E-17
sp|A6WU49|CYOE2_SHEB8 Protoheme IX farnesyltransferase 2 OS=Shewanella baltica (strain OS185) GN=cyoE2 PE=3 SV=1 10 263 2.0E-17
sp|Q6AF34|COXX_LEIXX Protoheme IX farnesyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=ctaB PE=3 SV=1 15 223 2.0E-17
sp|Q1J1C3|COXX_DEIGD Protoheme IX farnesyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=ctaB PE=3 SV=2 15 263 2.0E-17
sp|Q7NQZ3|COXX2_CHRVO Protoheme IX farnesyltransferase 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ctaB2 PE=3 SV=1 15 260 2.0E-17
sp|A3Q941|CYOE1_SHELP Protoheme IX farnesyltransferase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cyoE1 PE=3 SV=1 9 228 2.0E-17
sp|Q82VQ6|COXX_NITEU Protoheme IX farnesyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ctaB PE=3 SV=1 3 261 2.0E-17
sp|Q5WDX4|COXX_BACSK Protoheme IX farnesyltransferase OS=Bacillus clausii (strain KSM-K16) GN=ctaB PE=3 SV=1 8 208 2.0E-17
sp|A7N6I9|CYOE2_VIBCB Protoheme IX farnesyltransferase 2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cyoE2 PE=3 SV=1 21 250 2.0E-17
sp|Q5P2E3|COXX_AROAE Protoheme IX farnesyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ctaB PE=3 SV=1 16 261 2.0E-17
sp|Q0HPR0|CYOE2_SHESR Protoheme IX farnesyltransferase 2 OS=Shewanella sp. (strain MR-7) GN=cyoE2 PE=3 SV=1 15 261 3.0E-17
sp|A9MM32|CYOE_SALAR Protoheme IX farnesyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cyoE PE=3 SV=1 14 195 3.0E-17
sp|A7GNP0|COXX1_BACCN Protoheme IX farnesyltransferase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ctaB1 PE=3 SV=1 6 208 3.0E-17
sp|A5VD56|COXX_SPHWW Protoheme IX farnesyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ctaB PE=3 SV=1 34 237 3.0E-17
sp|Q1IEP0|CYOE2_PSEE4 Protoheme IX farnesyltransferase 2 OS=Pseudomonas entomophila (strain L48) GN=cyoE2 PE=3 SV=1 15 263 3.0E-17
sp|A1RE49|CYOE1_SHESW Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain W3-18-1) GN=cyoE1 PE=3 SV=1 10 263 3.0E-17
sp|Q5HAA6|COXX_EHRRW Protoheme IX farnesyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=ctaB PE=3 SV=1 20 263 3.0E-17
sp|Q5YTS1|COXX_NOCFA Protoheme IX farnesyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=ctaB PE=3 SV=1 13 237 3.0E-17
sp|Q8Z8V5|CYOE_SALTI Protoheme IX farnesyltransferase OS=Salmonella typhi GN=cyoE PE=3 SV=1 14 233 3.0E-17
sp|A1JNP6|CYOE_YERE8 Protoheme IX farnesyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cyoE PE=3 SV=1 14 252 3.0E-17
sp|Q5FGC3|COXX_EHRRG Protoheme IX farnesyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=ctaB PE=3 SV=1 20 263 3.0E-17
sp|A0L2I3|CYOE2_SHESA Protoheme IX farnesyltransferase 2 OS=Shewanella sp. (strain ANA-3) GN=cyoE2 PE=3 SV=1 15 261 3.0E-17
sp|C6DB46|CYOE_PECCP Protoheme IX farnesyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cyoE PE=3 SV=1 14 134 3.0E-17
sp|Q0HDH7|CYOE2_SHESM Protoheme IX farnesyltransferase 2 OS=Shewanella sp. (strain MR-4) GN=cyoE2 PE=3 SV=1 15 261 3.0E-17
sp|A6VRF6|CYOE_MARMS Protoheme IX farnesyltransferase OS=Marinomonas sp. (strain MWYL1) GN=cyoE PE=3 SV=1 15 252 4.0E-17
sp|Q3Z4X5|CYOE_SHISS Protoheme IX farnesyltransferase OS=Shigella sonnei (strain Ss046) GN=cyoE PE=3 SV=1 14 134 4.0E-17
sp|A9MWZ0|CYOE_SALPB Protoheme IX farnesyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cyoE PE=3 SV=1 14 233 4.0E-17
sp|O66544|COXX_AQUAE Protoheme IX farnesyltransferase OS=Aquifex aeolicus (strain VF5) GN=ctaB PE=3 SV=1 19 261 4.0E-17
sp|Q6MR11|COXX_BDEBA Protoheme IX farnesyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ctaB PE=3 SV=1 10 259 4.0E-17
sp|Q2NV87|CYOE_SODGM Protoheme IX farnesyltransferase OS=Sodalis glossinidius (strain morsitans) GN=cyoE PE=3 SV=2 15 130 4.0E-17
sp|Q8ZRC4|CYOE_SALTY Protoheme IX farnesyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cyoE PE=3 SV=1 14 233 4.0E-17
sp|Q5PFP5|CYOE_SALPA Protoheme IX farnesyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cyoE PE=3 SV=1 14 233 4.0E-17
sp|Q57SC4|CYOE_SALCH Protoheme IX farnesyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=cyoE PE=3 SV=2 14 233 4.0E-17
sp|Q9A301|COXX_CAUCR Protoheme IX farnesyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ctaB PE=3 SV=1 14 219 5.0E-17
sp|B6JDB7|COXX_OLICO Protoheme IX farnesyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ctaB PE=3 SV=1 14 238 6.0E-17
sp|A1KAQ4|COXX_AZOSB Protoheme IX farnesyltransferase OS=Azoarcus sp. (strain BH72) GN=ctaB PE=3 SV=1 9 261 6.0E-17
sp|Q60CP3|CYOE_METCA Protoheme IX farnesyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cyoE PE=3 SV=1 20 231 6.0E-17
sp|Q8P487|CYOE_XANCP Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cyoE PE=3 SV=2 21 222 7.0E-17
sp|B0RXJ1|CYOE_XANCB Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cyoE PE=3 SV=2 21 222 7.0E-17
sp|Q4UPT7|CYOE_XANC8 Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cyoE PE=3 SV=2 21 222 7.0E-17
sp|Q87IR2|CYOE1_VIBPA Protoheme IX farnesyltransferase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cyoE1 PE=3 SV=1 3 250 7.0E-17
sp|B8D7Z7|CYOE_BUCAT Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cyoE PE=3 SV=1 15 211 7.0E-17
sp|P57540|CYOE_BUCAI Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cyoE PE=3 SV=1 15 211 7.0E-17
sp|B8D9P5|CYOE_BUCA5 Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cyoE PE=3 SV=1 15 211 7.0E-17
sp|A3Q9U4|CYOE2_SHELP Protoheme IX farnesyltransferase 2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cyoE2 PE=3 SV=1 15 249 9.0E-17
sp|A4YC85|CYOE2_SHEPC Protoheme IX farnesyltransferase 2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cyoE2 PE=3 SV=1 10 233 1.0E-16
sp|P24009|COXX2_BACSU Protoheme IX farnesyltransferase 2 OS=Bacillus subtilis (strain 168) GN=ctaB2 PE=1 SV=2 13 207 1.0E-16
sp|Q3KK91|CYOE1_PSEPF Protoheme IX farnesyltransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=cyoE1 PE=3 SV=2 15 228 1.0E-16
sp|C1DG34|CYOE_AZOVD Protoheme IX farnesyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cyoE PE=3 SV=1 15 198 1.0E-16
sp|Q985X0|COXX2_RHILO Protoheme IX farnesyltransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=ctaB2 PE=3 SV=1 4 260 1.0E-16
sp|Q83SF7|CYOE_SHIFL Protoheme IX farnesyltransferase OS=Shigella flexneri GN=cyoE PE=3 SV=5 14 134 1.0E-16
sp|Q87IH5|CYOE2_VIBPA Protoheme IX farnesyltransferase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cyoE2 PE=3 SV=1 10 192 1.0E-16
sp|Q8CXI8|COXX_OCEIH Protoheme IX farnesyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ctaB PE=3 SV=1 16 198 1.0E-16
sp|A5UPV7|COXX_ROSS1 Protoheme IX farnesyltransferase OS=Roseiflexus sp. (strain RS-1) GN=ctaB PE=3 SV=1 10 255 1.0E-16
sp|Q11SZ7|COXX_CYTH3 Protoheme IX farnesyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ctaB PE=3 SV=2 21 260 2.0E-16
sp|A7HQW1|COXX_PARL1 Protoheme IX farnesyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ctaB PE=3 SV=1 16 205 2.0E-16
sp|A7Z4B1|COXX2_BACMF Protoheme IX farnesyltransferase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ctaB2 PE=3 SV=1 16 207 2.0E-16
sp|B1JDU9|CYOE2_PSEPW Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain W619) GN=cyoE2 PE=3 SV=1 15 263 2.0E-16
sp|A6WWG0|COXX_OCHA4 Protoheme IX farnesyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaB PE=3 SV=2 14 257 3.0E-16
sp|Q9I719|CYOE1_PSEAE Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cyoE1 PE=3 SV=1 7 229 3.0E-16
sp|Q02UW5|CYOE1_PSEAB Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cyoE1 PE=3 SV=1 7 229 3.0E-16
sp|A6UXP9|CYOE1_PSEA7 Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain PA7) GN=cyoE1 PE=3 SV=1 7 229 3.0E-16
sp|A9VUA6|COXX_BACWK Protoheme IX farnesyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ctaB PE=3 SV=1 16 203 3.0E-16
sp|A5CRS6|COXX_CLAM3 Protoheme IX farnesyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=ctaB PE=3 SV=1 15 228 3.0E-16
sp|B0T0X6|COXX_CAUSK Protoheme IX farnesyltransferase OS=Caulobacter sp. (strain K31) GN=ctaB PE=3 SV=1 14 254 3.0E-16
sp|A6T5H1|CYOE_KLEP7 Protoheme IX farnesyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cyoE PE=3 SV=1 14 233 3.0E-16
sp|B0JGA8|COXX_MICAN Protoheme IX farnesyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=ctaB PE=3 SV=1 34 258 4.0E-16
sp|Q88PN3|CYOE2_PSEPK Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=cyoE2 PE=3 SV=1 15 263 4.0E-16
sp|A5VYP1|CYOE2_PSEP1 Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cyoE2 PE=3 SV=1 15 263 4.0E-16
sp|A7MFG8|CYOE_CROS8 Protoheme IX farnesyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cyoE PE=3 SV=1 14 130 4.0E-16
sp|Q3J5F9|COXX_RHOS4 Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ctaB PE=1 SV=1 1 254 4.0E-16
sp|A3PGX5|COXX_RHOS1 Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ctaB PE=3 SV=1 1 254 4.0E-16
sp|Q2YCM2|COXX_NITMU Protoheme IX farnesyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ctaB PE=3 SV=1 3 262 4.0E-16
sp|A4W799|CYOE_ENT38 Protoheme IX farnesyltransferase OS=Enterobacter sp. (strain 638) GN=cyoE PE=3 SV=1 18 130 4.0E-16
sp|B0KPE4|CYOE2_PSEPG Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain GB-1) GN=cyoE2 PE=3 SV=1 15 263 4.0E-16
sp|A1WHP5|COXX_VEREI Protoheme IX farnesyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=ctaB PE=3 SV=1 22 261 4.0E-16
sp|B1KM58|CYOE1_SHEWM Protoheme IX farnesyltransferase 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cyoE1 PE=3 SV=1 9 228 5.0E-16
sp|Q5GV87|CYOE_XANOR Protoheme IX farnesyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cyoE PE=3 SV=2 21 222 5.0E-16
sp|Q2NYG1|CYOE_XANOM Protoheme IX farnesyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cyoE PE=3 SV=1 21 222 5.0E-16
sp|Q9WWR5|CYOE_PSEPU Protoheme IX farnesyltransferase OS=Pseudomonas putida GN=cyoE PE=3 SV=1 15 263 5.0E-16
sp|Q0S0I5|COXX_RHOJR Protoheme IX farnesyltransferase OS=Rhodococcus jostii (strain RHA1) GN=ctaB PE=3 SV=2 13 237 5.0E-16
sp|B9KLZ5|COXX_RHOSK Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ctaB PE=3 SV=1 1 254 5.0E-16
sp|P67054|COXX_BRUSU Protoheme IX farnesyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=ctaB PE=3 SV=2 14 252 5.0E-16
sp|A5VP40|COXX_BRUO2 Protoheme IX farnesyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctaB PE=3 SV=1 14 252 5.0E-16
sp|P67053|COXX_BRUME Protoheme IX farnesyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctaB PE=3 SV=2 14 252 5.0E-16
sp|B0CKF4|COXX_BRUSI Protoheme IX farnesyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctaB PE=3 SV=1 14 252 6.0E-16
sp|C0RHH6|COXX_BRUMB Protoheme IX farnesyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ctaB PE=3 SV=1 14 252 6.0E-16
sp|A9M8Z3|COXX_BRUC2 Protoheme IX farnesyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctaB PE=3 SV=1 14 252 6.0E-16
sp|B1XS75|COXX_POLNS Protoheme IX farnesyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ctaB PE=3 SV=1 14 245 6.0E-16
sp|P56938|COXX_RHOSH Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides GN=ctaB PE=3 SV=1 1 260 6.0E-16
sp|Q04444|COXX_BACPE Protoheme IX farnesyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=ctaB PE=3 SV=1 21 225 6.0E-16
sp|Q2GDE4|COXX_NEOSM Protoheme IX farnesyltransferase OS=Neorickettsia sennetsu (strain Miyayama) GN=ctaB PE=3 SV=1 7 259 7.0E-16
sp|A1AV76|CYOE_RUTMC Protoheme IX farnesyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=cyoE PE=3 SV=1 15 198 7.0E-16
sp|Q2GFJ2|COXX_EHRCR Protoheme IX farnesyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ctaB PE=3 SV=1 23 222 8.0E-16
sp|Q28MJ1|COXX_JANSC Protoheme IX farnesyltransferase OS=Jannaschia sp. (strain CCS1) GN=ctaB PE=3 SV=1 25 254 8.0E-16
sp|Q0ABY1|CYOE_ALKEH Protoheme IX farnesyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cyoE PE=3 SV=2 20 222 8.0E-16
sp|Q49WP1|COXX_STAS1 Protoheme IX farnesyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ctaB PE=3 SV=1 11 205 8.0E-16
sp|A7NRY4|COXX_ROSCS Protoheme IX farnesyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ctaB PE=3 SV=1 10 198 9.0E-16
sp|B0REI2|COXX_CLAMS Protoheme IX farnesyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=ctaB PE=3 SV=1 15 228 9.0E-16
sp|Q1IGZ4|CYOE1_PSEE4 Protoheme IX farnesyltransferase 1 OS=Pseudomonas entomophila (strain L48) GN=cyoE1 PE=3 SV=1 15 222 1.0E-15
sp|A8FPN0|CYOE_SHESH Protoheme IX farnesyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=cyoE PE=3 SV=1 33 250 1.0E-15
sp|Q87DT0|CYOE_XYLFT Protoheme IX farnesyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cyoE PE=3 SV=2 21 250 1.0E-15
sp|C0R2X3|COXX_WOLWR Protoheme IX farnesyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=ctaB PE=3 SV=1 17 211 1.0E-15
sp|A5CXZ0|CYOE_VESOH Protoheme IX farnesyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=cyoE PE=3 SV=1 15 198 1.0E-15
sp|Q1LRS0|COXX_CUPMC Protoheme IX farnesyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ctaB PE=3 SV=2 10 261 1.0E-15
sp|Q6G4C6|COXX_BARHE Protoheme IX farnesyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ctaB PE=3 SV=1 33 254 1.0E-15
sp|Q7NIL7|COXX_GLOVI Protoheme IX farnesyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=ctaB PE=3 SV=1 26 206 1.0E-15
sp|Q6MBY2|COXX_PARUW Protoheme IX farnesyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=ctaB PE=3 SV=1 15 181 1.0E-15
sp|Q3BND5|CYOE_XANC5 Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cyoE PE=3 SV=1 21 198 1.0E-15
sp|Q9I423|CYOE2_PSEAE Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cyoE2 PE=3 SV=1 15 252 1.0E-15
sp|Q02JG2|CYOE2_PSEAB Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cyoE2 PE=3 SV=1 15 252 1.0E-15
sp|B1MC66|COXX_MYCA9 Protoheme IX farnesyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ctaB PE=3 SV=1 15 203 2.0E-15
sp|A0QWY2|COXX_MYCS2 Protoheme IX farnesyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctaB PE=3 SV=1 15 203 2.0E-15
sp|A1SJR1|COXX_NOCSJ Protoheme IX farnesyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=ctaB PE=3 SV=1 15 198 2.0E-15
sp|A4XNK8|CYOE_PSEMY Protoheme IX farnesyltransferase OS=Pseudomonas mendocina (strain ymp) GN=cyoE PE=3 SV=1 15 209 2.0E-15
sp|Q9PDL9|CYOE_XYLFA Protoheme IX farnesyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=cyoE PE=3 SV=2 21 250 2.0E-15
sp|B3CN58|COXX_WOLPP Protoheme IX farnesyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=ctaB PE=3 SV=1 25 222 2.0E-15
sp|A6V8N8|CYOE2_PSEA7 Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain PA7) GN=cyoE2 PE=3 SV=1 15 252 2.0E-15
sp|A6T2T7|COXX_JANMA Protoheme IX farnesyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=ctaB PE=3 SV=1 15 263 2.0E-15
sp|B8H7N5|COXX_ARTCA Protoheme IX farnesyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ctaB PE=3 SV=1 12 241 3.0E-15
sp|Q5N1X0|COXX_SYNP6 Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ctaB PE=3 SV=1 17 209 3.0E-15
sp|Q31JY9|COXX_SYNE7 Protoheme IX farnesyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=ctaB PE=3 SV=2 17 209 3.0E-15
sp|Q8F9F8|COXX_LEPIN Protoheme IX farnesyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ctaB PE=3 SV=1 19 221 3.0E-15
sp|Q72VU2|COXX_LEPIC Protoheme IX farnesyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ctaB PE=3 SV=1 19 221 3.0E-15
sp|A4TC38|COXX_MYCGI Protoheme IX farnesyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ctaB PE=3 SV=1 15 203 4.0E-15
sp|Q055W1|COXX_LEPBL Protoheme IX farnesyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ctaB PE=3 SV=1 7 221 4.0E-15
sp|Q04PG4|COXX_LEPBJ Protoheme IX farnesyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ctaB PE=3 SV=1 7 221 4.0E-15
sp|Q66DU5|CYOE_YERPS Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cyoE PE=3 SV=1 14 134 4.0E-15
sp|A4TPF3|CYOE_YERPP Protoheme IX farnesyltransferase OS=Yersinia pestis (strain Pestoides F) GN=cyoE PE=3 SV=2 14 134 4.0E-15
sp|Q1CL75|CYOE_YERPN Protoheme IX farnesyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cyoE PE=3 SV=2 14 134 4.0E-15
sp|Q0WCB5|CYOE_YERPE Protoheme IX farnesyltransferase OS=Yersinia pestis GN=cyoE PE=3 SV=1 14 134 4.0E-15
sp|Q1C4J8|CYOE_YERPA Protoheme IX farnesyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cyoE PE=3 SV=2 14 134 4.0E-15
sp|B1JHT2|CYOE_YERPY Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cyoE PE=3 SV=1 14 134 4.0E-15
sp|A7FLD4|CYOE_YERP3 Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cyoE PE=3 SV=1 14 134 4.0E-15
sp|Q5SLI3|COXX_THET8 Protoheme IX farnesyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ctaB PE=3 SV=1 13 220 4.0E-15
sp|Q72H22|COXX_THET2 Protoheme IX farnesyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ctaB PE=3 SV=1 13 220 4.0E-15
sp|Q73I75|COXX_WOLPM Protoheme IX farnesyltransferase OS=Wolbachia pipientis wMel GN=ctaB PE=3 SV=1 17 195 4.0E-15
sp|Q8PFU4|CYOE_XANAC Protoheme IX farnesyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cyoE PE=3 SV=1 21 198 4.0E-15
sp|P9WFR7|COXX_MYCTU Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctaB PE=3 SV=1 15 203 4.0E-15
sp|P9WFR6|COXX_MYCTO Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctaB PE=3 SV=1 15 203 4.0E-15
sp|A1QRH1|COXX_MYCTF Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain F11) GN=ctaB1 PE=3 SV=1 15 203 4.0E-15
sp|A5U2F4|COXX_MYCTA Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ctaB PE=3 SV=1 15 203 4.0E-15
sp|Q4KKL2|CYOE1_PSEF5 Protoheme IX farnesyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cyoE1 PE=3 SV=1 15 209 4.0E-15
sp|A4T079|COXX_POLSQ Protoheme IX farnesyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ctaB PE=3 SV=1 14 224 4.0E-15
sp|A0PPP7|COXX_MYCUA Protoheme IX farnesyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=ctaB PE=3 SV=1 14 203 4.0E-15
sp|Q21XT4|COXX_RHOFT Protoheme IX farnesyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ctaB PE=3 SV=1 4 261 5.0E-15
sp|A1T8M8|COXX_MYCVP Protoheme IX farnesyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ctaB PE=3 SV=1 15 203 5.0E-15
sp|A5EA98|COXX_BRASB Protoheme IX farnesyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ctaB PE=3 SV=1 14 198 5.0E-15
sp|A4F9B0|COXX1_SACEN Protoheme IX farnesyltransferase 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ctaB1 PE=3 SV=2 15 255 5.0E-15
sp|A4Z2D2|COXX_BRASO Protoheme IX farnesyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=ctaB PE=3 SV=1 16 198 5.0E-15
sp|Q9RM98|COXX_BRADU Protoheme IX farnesyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ctaB PE=3 SV=1 14 196 5.0E-15
sp|Q07HB2|COXX_RHOP5 Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=ctaB PE=3 SV=1 33 198 6.0E-15
sp|Q6F9R1|CYOE_ACIAD Protoheme IX farnesyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cyoE PE=3 SV=2 28 130 6.0E-15
sp|Q0AMG9|COXX_MARMM Protoheme IX farnesyltransferase OS=Maricaulis maris (strain MCS10) GN=ctaB PE=3 SV=1 33 257 6.0E-15
sp|A8GN36|COXX_RICAH Protoheme IX farnesyltransferase OS=Rickettsia akari (strain Hartford) GN=ctaB PE=3 SV=1 24 129 7.0E-15
sp|Q1B9B1|COXX_MYCSS Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain MCS) GN=ctaB PE=3 SV=2 15 203 7.0E-15
sp|A1UFQ0|COXX_MYCSK Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain KMS) GN=ctaB PE=3 SV=2 15 203 7.0E-15
sp|A3PZB2|COXX_MYCSJ Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain JLS) GN=ctaB PE=3 SV=1 15 203 7.0E-15
sp|Q7VRH6|CYOE_BLOFL Protoheme IX farnesyltransferase OS=Blochmannia floridanus GN=cyoE PE=3 SV=1 15 233 8.0E-15
sp|A0JWQ8|COXX_ARTS2 Protoheme IX farnesyltransferase OS=Arthrobacter sp. (strain FB24) GN=ctaB PE=3 SV=1 15 241 8.0E-15
sp|Q2IR91|COXX_RHOP2 Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=ctaB PE=3 SV=1 33 198 9.0E-15
sp|Q4FPD2|COXX_PELUB Protoheme IX farnesyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=ctaB PE=3 SV=2 27 263 9.0E-15
sp|Q5NI07|CYOE_FRATT Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|Q14JF9|CYOE_FRAT1 Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|B2AGR8|COXX_CUPTR Protoheme IX farnesyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ctaB PE=3 SV=2 14 261 1.0E-14
sp|A4WQ57|COXX_RHOS5 Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ctaB PE=3 SV=1 25 254 1.0E-14
sp|A4IZX0|CYOE_FRATW Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|Q0BNW5|CYOE_FRATO Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|A0Q4E4|CYOE_FRATN Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|Q2A5L1|CYOE_FRATH Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cyoE PE=3 SV=1 13 263 1.0E-14
sp|A4ILX0|COXX_GEOTN Protoheme IX farnesyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ctaB PE=3 SV=1 15 207 1.0E-14
sp|Q9K9M9|COXX_BACHD Protoheme IX farnesyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ctaB PE=3 SV=1 3 207 1.0E-14
sp|B7IVI2|COXX_BACC2 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain G9842) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|Q2G9W3|COXX_NOVAD Protoheme IX farnesyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ctaB PE=3 SV=1 10 221 1.0E-14
sp|Q819N1|COXX_BACCR Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ctaB PE=3 SV=2 16 198 1.0E-14
sp|B9IW24|COXX_BACCQ Protoheme IX farnesyltransferase OS=Bacillus cereus (strain Q1) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|B7HMC9|COXX_BACC7 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain AH187) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|B7H6T1|COXX_BACC4 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain B4264) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|Q732C2|COXX_BACC1 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|B9EB27|COXX_MACCJ Protoheme IX farnesyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ctaB PE=3 SV=1 11 217 1.0E-14
sp|Q6HEL9|COXX_BACHK Protoheme IX farnesyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|Q635Y1|COXX_BACCZ Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|B7JK33|COXX_BACC0 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain AH820) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|Q81MT8|COXX_BACAN Protoheme IX farnesyltransferase OS=Bacillus anthracis GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|C3LI11|COXX_BACAC Protoheme IX farnesyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|C3P6V2|COXX_BACAA Protoheme IX farnesyltransferase OS=Bacillus anthracis (strain A0248) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|A8EZ97|COXX_RICCK Protoheme IX farnesyltransferase OS=Rickettsia canadensis (strain McKiel) GN=ctaB PE=3 SV=1 27 261 1.0E-14
sp|Q1QHV7|COXX_NITHX Protoheme IX farnesyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ctaB1 PE=3 SV=2 14 254 1.0E-14
sp|C1EPV9|COXX_BACC3 Protoheme IX farnesyltransferase OS=Bacillus cereus (strain 03BB102) GN=ctaB PE=3 SV=1 16 198 1.0E-14
sp|A0RHW3|COXX_BACAH Protoheme IX farnesyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=ctaB PE=3 SV=2 16 198 1.0E-14
sp|Q9RR78|COXX_DEIRA Protoheme IX farnesyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ctaB PE=3 SV=1 15 233 1.0E-14
sp|B4SHI1|CYOE_STRM5 Protoheme IX farnesyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=cyoE PE=3 SV=1 21 227 1.0E-14
sp|C1AN96|COXX_MYCBT Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ctaB PE=3 SV=1 15 203 1.0E-14
sp|A1KIP0|COXX_MYCBP Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ctaB PE=3 SV=1 15 203 1.0E-14
sp|Q7U021|COXX_MYCBO Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctaB PE=3 SV=1 15 203 1.0E-14
sp|Q5HQ51|COXX_STAEQ Protoheme IX farnesyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ctaB PE=3 SV=1 11 209 1.0E-14
sp|Q8NX68|COXX_STAAW Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MW2) GN=ctaB PE=3 SV=1 11 209 1.0E-14
sp|Q6GA98|COXX_STAAS Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=ctaB PE=3 SV=1 11 209 1.0E-14
sp|Q6GHW9|COXX_STAAR Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=ctaB PE=3 SV=1 11 209 1.0E-14
sp|Q2YX83|COXX_STAAB Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ctaB PE=3 SV=1 11 209 1.0E-14
sp|Q493G3|CYOE_BLOPB Protoheme IX farnesyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cyoE PE=3 SV=1 15 263 1.0E-14
sp|A8LHT6|COXX_DINSH Protoheme IX farnesyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ctaB PE=3 SV=2 16 254 1.0E-14
sp|Q2T1F6|COXX_BURTA Protoheme IX farnesyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ctaB PE=3 SV=1 10 261 2.0E-14
sp|Q88RL9|CYOE1_PSEPK Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain KT2440) GN=cyoE1 PE=3 SV=1 15 254 2.0E-14
sp|A5VWP2|CYOE1_PSEP1 Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cyoE1 PE=3 SV=1 15 222 2.0E-14
sp|Q47G19|COXX_DECAR Protoheme IX farnesyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ctaB PE=3 SV=1 20 198 2.0E-14
sp|A1URX1|COXX_BARBK Protoheme IX farnesyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctaB PE=3 SV=1 33 259 2.0E-14
sp|A8GVN8|COXX_RICB8 Protoheme IX farnesyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=ctaB PE=3 SV=1 5 261 2.0E-14
sp|A7N9N4|CYOE_FRATF Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cyoE PE=3 SV=1 13 263 2.0E-14
sp|Q13CY5|COXX_RHOPS Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=ctaB PE=3 SV=1 33 198 2.0E-14
sp|Q8CPM1|COXX_STAES Protoheme IX farnesyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ctaB PE=3 SV=2 11 209 2.0E-14
sp|A8Z1Q1|COXX_STAAT Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|Q7A664|COXX_STAAN Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain N315) GN=ctaB PE=3 SV=2 11 209 2.0E-14
sp|Q99UY7|COXX_STAAM Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ctaB PE=3 SV=2 11 209 2.0E-14
sp|A6QFX1|COXX_STAAE Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Newman) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|Q5HGW8|COXX_STAAC Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain COL) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|A5IS03|COXX_STAA9 Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain JH9) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|Q2G2B9|COXX_STAA8 Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|Q2FHW4|COXX_STAA3 Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain USA300) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|A6U0T4|COXX_STAA2 Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain JH1) GN=ctaB PE=3 SV=1 11 209 2.0E-14
sp|A7X128|COXX_STAA1 Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ctaB PE=3 SV=2 11 209 2.0E-14
sp|A4G936|COXX_HERAR Protoheme IX farnesyltransferase OS=Herminiimonas arsenicoxydans GN=ctaB PE=3 SV=1 15 261 2.0E-14
sp|Q4UM22|COXX_RICFE Protoheme IX farnesyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ctaB PE=3 SV=1 20 129 2.0E-14
sp|B1HST2|COXX2_LYSSC Protoheme IX farnesyltransferase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=ctaB2 PE=3 SV=2 13 198 3.0E-14
sp|B1YN86|COXX_BURA4 Protoheme IX farnesyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=ctaB PE=3 SV=1 10 261 3.0E-14
sp|A1R6I0|COXX_ARTAT Protoheme IX farnesyltransferase OS=Arthrobacter aurescens (strain TC1) GN=ctaB PE=3 SV=1 12 241 3.0E-14
sp|Q4L5D0|COXX_STAHJ Protoheme IX farnesyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ctaB PE=3 SV=1 11 209 3.0E-14
sp|A2SKN7|COXX_METPP Protoheme IX farnesyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=ctaB PE=3 SV=1 15 261 3.0E-14
sp|A0KME5|CYOE_AERHH Protoheme IX farnesyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cyoE PE=3 SV=2 13 134 3.0E-14
sp|Q1LTJ4|CYOE_BAUCH Protoheme IX farnesyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cyoE PE=3 SV=1 15 134 3.0E-14
sp|Q20X25|COXX_RHOPB Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=ctaB PE=3 SV=1 14 198 3.0E-14
sp|Q476H8|COXX_CUPPJ Protoheme IX farnesyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ctaB PE=3 SV=2 10 261 4.0E-14
sp|B3PSB2|COXX_RHIE6 Protoheme IX farnesyltransferase OS=Rhizobium etli (strain CIAT 652) GN=ctaB PE=3 SV=1 16 253 4.0E-14
sp|A5G0I2|COXX_ACICJ Protoheme IX farnesyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=ctaB PE=3 SV=1 33 219 4.0E-14
sp|A9WAQ6|COXX_CHLAA Protoheme IX farnesyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ctaB PE=3 SV=1 33 257 4.0E-14
sp|Q11KD2|COXX_CHESB Protoheme IX farnesyltransferase OS=Chelativorans sp. (strain BNC1) GN=ctaB PE=3 SV=1 16 238 4.0E-14
sp|Q8FT77|COXX_COREF Protoheme IX farnesyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ctaB PE=3 SV=2 13 201 5.0E-14
sp|Q63XS7|COXX_BURPS Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|A3N5D1|COXX_BURP6 Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 668) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|Q3JWF7|COXX_BURP1 Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|A3NR29|COXX_BURP0 Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|Q8NQ66|COXX_CORGL Protoheme IX farnesyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ctaB PE=3 SV=1 13 237 5.0E-14
sp|A4QEE9|COXX_CORGB Protoheme IX farnesyltransferase OS=Corynebacterium glutamicum (strain R) GN=ctaB PE=3 SV=1 13 237 5.0E-14
sp|Q9ZDI2|COXX_RICPR Protoheme IX farnesyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=ctaB PE=3 SV=1 10 129 5.0E-14
sp|Q3SUL3|COXX2_NITWN Protoheme IX farnesyltransferase 2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ctaB2 PE=3 SV=2 16 238 5.0E-14
sp|Q3SW48|COXX1_NITWN Protoheme IX farnesyltransferase 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ctaB1 PE=3 SV=1 16 238 5.0E-14
sp|A1UZV8|COXX_BURMS Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain SAVP1) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|Q62F61|COXX_BURMA Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|A2S646|COXX_BURM9 Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|A3MQ44|COXX_BURM7 Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=ctaB PE=3 SV=1 10 261 5.0E-14
sp|A4SPY8|CYOE_AERS4 Protoheme IX farnesyltransferase OS=Aeromonas salmonicida (strain A449) GN=cyoE PE=3 SV=2 13 134 6.0E-14
sp|Q167W1|COXX_ROSDO Protoheme IX farnesyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ctaB PE=3 SV=1 4 257 6.0E-14
sp|Q8Y2G4|COXX_RALSO Protoheme IX farnesyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ctaB PE=3 SV=2 14 261 7.0E-14
sp|Q0KER8|COXX_CUPNH Protoheme IX farnesyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ctaB PE=3 SV=1 10 261 7.0E-14
sp|Q1RI93|COXX_RICBR Protoheme IX farnesyltransferase OS=Rickettsia bellii (strain RML369-C) GN=ctaB PE=3 SV=1 5 261 8.0E-14
sp|B0KFZ0|CYOE1_PSEPG Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain GB-1) GN=cyoE1 PE=3 SV=1 15 222 8.0E-14
sp|A1VKM6|COXX_POLNA Protoheme IX farnesyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ctaB PE=3 SV=1 4 261 8.0E-14
sp|A7GRX3|COXX2_BACCN Protoheme IX farnesyltransferase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ctaB2 PE=3 SV=2 16 203 9.0E-14
sp|Q0BBM3|COXX_BURCM Protoheme IX farnesyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ctaB PE=3 SV=1 10 261 1.0E-13
sp|A1TU04|COXX_ACIAC Protoheme IX farnesyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ctaB PE=3 SV=1 22 261 1.0E-13
sp|Q6G0D0|COXX_BARQU Protoheme IX farnesyltransferase OS=Bartonella quintana (strain Toulouse) GN=ctaB PE=3 SV=1 32 253 1.0E-13
sp|A0QHX0|COXX_MYCA1 Protoheme IX farnesyltransferase OS=Mycobacterium avium (strain 104) GN=ctaB PE=3 SV=2 11 203 1.0E-13
sp|Q5L114|COXX_GEOKA Protoheme IX farnesyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=ctaB PE=3 SV=1 19 200 1.0E-13
sp|Q12E37|COXX_POLSJ Protoheme IX farnesyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ctaB PE=3 SV=1 22 261 1.0E-13
sp|A9WT38|COXX_RENSM Protoheme IX farnesyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=ctaB PE=3 SV=1 15 225 1.0E-13
sp|Q741B3|COXX_MYCPA Protoheme IX farnesyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ctaB PE=3 SV=1 11 203 1.0E-13
sp|A1SBD7|CYOE_SHEAM Protoheme IX farnesyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cyoE PE=3 SV=1 9 250 1.0E-13
sp|Q6NBJ5|COXX_RHOPA Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ctaB PE=3 SV=2 33 198 2.0E-13
sp|Q5P9Y8|COXX_ANAMM Protoheme IX farnesyltransferase OS=Anaplasma marginale (strain St. Maries) GN=ctaB PE=3 SV=1 33 215 2.0E-13
sp|B9KGP6|COXX_ANAMF Protoheme IX farnesyltransferase OS=Anaplasma marginale (strain Florida) GN=ctaB PE=3 SV=1 33 215 2.0E-13
sp|Q2KTX0|COXX_BORA1 Protoheme IX farnesyltransferase OS=Bordetella avium (strain 197N) GN=ctaB PE=3 SV=1 4 261 2.0E-13
sp|A1BA40|COXX_PARDP Protoheme IX farnesyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=ctaB PE=3 SV=1 3 258 2.0E-13
sp|A9IQQ6|COXX_BART1 Protoheme IX farnesyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ctaB PE=3 SV=1 1 253 2.0E-13
sp|B9DPV9|COXX_STACT Protoheme IX farnesyltransferase OS=Staphylococcus carnosus (strain TM300) GN=ctaB PE=3 SV=1 11 196 2.0E-13
sp|Q72B27|COXX_DESVH Protoheme IX farnesyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ctaB PE=3 SV=1 11 191 2.0E-13
sp|A1VD51|COXX_DESVV Protoheme IX farnesyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ctaB PE=3 SV=1 11 191 2.0E-13
sp|Q98LF1|COXX1_RHILO Protoheme IX farnesyltransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=ctaB1 PE=3 SV=1 33 237 2.0E-13
sp|Q1MKI5|COXX_RHIL3 Protoheme IX farnesyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ctaB PE=3 SV=1 6 253 3.0E-13
sp|B0V7G8|CYOE_ACIBY Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AYE) GN=cyoE PE=3 SV=1 21 130 3.0E-13
sp|A3M6Q3|CYOE_ACIBT Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cyoE PE=3 SV=2 21 130 3.0E-13
sp|B0VM11|CYOE_ACIBS Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain SDF) GN=cyoE PE=3 SV=1 21 130 3.0E-13
sp|B7IBC0|CYOE_ACIB5 Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=cyoE PE=3 SV=1 21 130 3.0E-13
sp|B7H0K1|CYOE_ACIB3 Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=cyoE PE=3 SV=1 21 130 3.0E-13
sp|C4K2Q8|COXX_RICPU Protoheme IX farnesyltransferase OS=Rickettsia peacockii (strain Rustic) GN=ctaB PE=3 SV=1 20 237 3.0E-13
sp|B9JAP1|COXX_AGRRK Protoheme IX farnesyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ctaB PE=3 SV=1 16 253 4.0E-13
sp|Q39CQ5|COXX_BURL3 Protoheme IX farnesyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ctaB PE=3 SV=1 10 261 4.0E-13
sp|B4EA84|COXX_BURCJ Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ctaB PE=3 SV=1 10 261 4.0E-13
sp|A0KAR0|COXX_BURCH Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=ctaB PE=3 SV=1 10 261 4.0E-13
sp|B1JZ41|COXX_BURCC Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=ctaB PE=3 SV=1 10 261 4.0E-13
sp|Q1BTD0|COXX_BURCA Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=ctaB PE=3 SV=1 10 261 4.0E-13
sp|Q5FPU4|COXX_GLUOX Protoheme IX farnesyltransferase OS=Gluconobacter oxydans (strain 621H) GN=ctaB PE=3 SV=1 2 203 4.0E-13
sp|Q7P0G0|COXX1_CHRVO Protoheme IX farnesyltransferase 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ctaB1 PE=3 SV=1 15 222 4.0E-13
sp|Q3SLW5|COXX_THIDA Protoheme IX farnesyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ctaB PE=3 SV=1 18 198 5.0E-13
sp|B1HPV1|COXX1_LYSSC Protoheme IX farnesyltransferase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=ctaB1 PE=3 SV=1 13 209 5.0E-13
sp|Q7N0K3|CYOE_PHOLL Protoheme IX farnesyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cyoE PE=3 SV=1 14 134 5.0E-13
sp|Q2KBM1|COXX_RHIEC Protoheme IX farnesyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ctaB PE=3 SV=1 16 253 5.0E-13
sp|Q0C3D1|COXX_HYPNA Protoheme IX farnesyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ctaB PE=3 SV=1 27 233 7.0E-13
sp|A4JI25|COXX_BURVG Protoheme IX farnesyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ctaB PE=3 SV=1 10 261 8.0E-13
sp|B7KVJ7|COXX_METC4 Protoheme IX farnesyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ctaB PE=3 SV=1 16 196 8.0E-13
sp|Q5GSX9|COXX_WOLTR Protoheme IX farnesyltransferase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=ctaB PE=3 SV=1 17 198 9.0E-13
sp|Q92IF1|COXX_RICCN Protoheme IX farnesyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ctaB PE=3 SV=1 20 129 1.0E-12
sp|C3PN58|COXX_RICAE Protoheme IX farnesyltransferase OS=Rickettsia africae (strain ESF-5) GN=ctaB PE=3 SV=1 20 129 1.0E-12
sp|B0UFS2|COXX_METS4 Protoheme IX farnesyltransferase OS=Methylobacterium sp. (strain 4-46) GN=ctaB PE=3 SV=1 16 196 1.0E-12
sp|A8F1B6|COXX_RICM5 Protoheme IX farnesyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=ctaB PE=3 SV=2 20 129 1.0E-12
sp|A8GRQ1|COXX_RICRS Protoheme IX farnesyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=ctaB PE=3 SV=1 20 129 1.0E-12
sp|B0BX58|COXX_RICRO Protoheme IX farnesyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=ctaB PE=3 SV=1 20 129 1.0E-12
sp|B1J467|CYOE1_PSEPW Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain W619) GN=cyoE1 PE=3 SV=1 15 222 1.0E-12
sp|B1ZKN8|COXX_METPB Protoheme IX farnesyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ctaB PE=3 SV=1 16 196 1.0E-12
sp|A7N2M2|CYOE1_VIBCB Protoheme IX farnesyltransferase 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cyoE1 PE=3 SV=1 28 192 2.0E-12
sp|Q5LNX8|COXX_RUEPO Protoheme IX farnesyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ctaB PE=3 SV=1 25 209 2.0E-12
sp|A1WBL5|COXX_ACISJ Protoheme IX farnesyltransferase OS=Acidovorax sp. (strain JS42) GN=ctaB PE=3 SV=1 22 261 2.0E-12
sp|B9MF14|COXX_ACIET Protoheme IX farnesyltransferase OS=Acidovorax ebreus (strain TPSY) GN=ctaB PE=3 SV=1 22 261 2.0E-12
sp|B5ZSV2|COXX_RHILW Protoheme IX farnesyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ctaB PE=3 SV=1 16 253 2.0E-12
sp|P08301|COXX_PARDE Protoheme IX farnesyltransferase OS=Paracoccus denitrificans GN=ctaB PE=3 SV=2 3 258 3.0E-12
sp|Q146A1|COXX_BURXL Protoheme IX farnesyltransferase OS=Burkholderia xenovorans (strain LB400) GN=ctaB PE=3 SV=1 16 261 3.0E-12
sp|C5D862|COXX_GEOSW Protoheme IX farnesyltransferase OS=Geobacillus sp. (strain WCH70) GN=ctaB PE=3 SV=1 15 198 3.0E-12
sp|Q5V5S6|COXX_HALMA Protoheme IX farnesyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ctaB PE=3 SV=1 12 238 3.0E-12
sp|B0SMP1|COXX_LEPBP Protoheme IX farnesyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ctaB PE=3 SV=2 12 198 4.0E-12
sp|B0SE58|COXX_LEPBA Protoheme IX farnesyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ctaB PE=3 SV=2 12 198 4.0E-12
sp|Q18JU9|COXX_HALWD Protoheme IX farnesyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ctaB PE=3 SV=1 15 198 5.0E-12
sp|Q9CCN4|COXX_MYCLE Protoheme IX farnesyltransferase OS=Mycobacterium leprae (strain TN) GN=ctaB PE=3 SV=2 15 203 2.0E-11
sp|Q6L147|COXX1_PICTO Protoheme IX farnesyltransferase 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ctaB1 PE=3 SV=1 27 222 2.0E-11
sp|Q6NH44|COXX_CORDI Protoheme IX farnesyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ctaB PE=3 SV=2 25 201 2.0E-11
sp|Q83GF8|COXX_TROWT Protoheme IX farnesyltransferase OS=Tropheryma whipplei (strain Twist) GN=ctaB PE=3 SV=1 42 229 3.0E-11
sp|Q83NK0|COXX_TROW8 Protoheme IX farnesyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=ctaB PE=3 SV=1 42 229 3.0E-11
sp|B2IGJ6|COXX_BEII9 Protoheme IX farnesyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ctaB PE=3 SV=1 1 196 4.0E-11
sp|A9HWL4|COXX_BORPD Protoheme IX farnesyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ctaB PE=3 SV=1 21 261 7.0E-11
sp|C3MHJ3|COXX_RHISN Protoheme IX farnesyltransferase OS=Rhizobium sp. (strain NGR234) GN=ctaB PE=3 SV=1 16 234 8.0E-11
sp|Q83CV6|CYOE_COXBU Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cyoE PE=3 SV=1 15 136 8.0E-11
sp|A9NCT0|CYOE_COXBR Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cyoE PE=3 SV=1 15 136 8.0E-11
sp|A9KCC9|CYOE_COXBN Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cyoE PE=3 SV=1 15 136 8.0E-11
sp|B6J085|CYOE_COXB2 Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=cyoE PE=3 SV=1 15 136 8.0E-11
sp|B6J736|CYOE_COXB1 Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=cyoE PE=3 SV=1 15 136 8.0E-11
sp|B1YIW5|COXX_EXIS2 Protoheme IX farnesyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ctaB PE=3 SV=1 22 200 9.0E-11
sp|Q1GE49|COXX_RUEST Protoheme IX farnesyltransferase OS=Ruegeria sp. (strain TM1040) GN=ctaB PE=3 SV=1 25 257 2.0E-10
sp|A9CJX3|COXX_AGRFC Protoheme IX farnesyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ctaB PE=3 SV=1 16 196 2.0E-10
sp|A5CF31|COXX_ORITB Protoheme IX farnesyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=ctaB PE=3 SV=1 27 192 4.0E-10
sp|B1M595|COXX_METRJ Protoheme IX farnesyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ctaB PE=3 SV=1 16 260 6.0E-10
sp|Q92RG8|COXX_RHIME Protoheme IX farnesyltransferase OS=Rhizobium meliloti (strain 1021) GN=ctaB PE=3 SV=2 16 234 6.0E-10
sp|A8IDL3|COXX_AZOC5 Protoheme IX farnesyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ctaB PE=3 SV=2 33 219 7.0E-10
sp|B3CTF6|COXX_ORITI Protoheme IX farnesyltransferase OS=Orientia tsutsugamushi (strain Ikeda) GN=ctaB PE=3 SV=1 6 129 7.0E-10
sp|A6U6U6|COXX_SINMW Protoheme IX farnesyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=ctaB PE=3 SV=1 16 233 7.0E-10
sp|B1I6G5|COXX_DESAP Protoheme IX farnesyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=ctaB PE=3 SV=1 21 198 7.0E-10
sp|Q9HRJ8|COXX_HALSA Protoheme IX farnesyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ctaB PE=3 SV=1 22 228 1.0E-09
sp|B0R3W4|COXX_HALS3 Protoheme IX farnesyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=ctaB PE=3 SV=1 22 228 1.0E-09
sp|Q7W316|COXX_BORPA Protoheme IX farnesyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ctaB PE=3 SV=1 21 203 1.0E-09
sp|Q7WE16|COXX_BORBR Protoheme IX farnesyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ctaB PE=3 SV=1 21 203 1.0E-09
sp|Q7VT22|COXX_BORPE Protoheme IX farnesyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ctaB PE=3 SV=1 21 198 2.0E-09
sp|Q1QYZ3|CYOE_CHRSD Protoheme IX farnesyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cyoE PE=3 SV=2 15 134 2.0E-09
sp|A0RZ28|COXX2_CENSY Protoheme IX farnesyltransferase 2 OS=Cenarchaeum symbiosum (strain A) GN=ctaB2 PE=3 SV=1 27 206 2.0E-09
sp|Q7U550|COXX_SYNPX Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain WH8102) GN=ctaB PE=3 SV=1 1 211 2.0E-09
sp|A5GMY0|COXX_SYNPW Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain WH7803) GN=ctaB PE=3 SV=1 1 211 3.0E-09
sp|Q3ALZ8|COXX_SYNSC Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain CC9605) GN=ctaB PE=3 SV=1 1 210 5.0E-09
sp|B8EPK3|COXX_METSB Protoheme IX farnesyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ctaB PE=3 SV=1 1 218 7.0E-09
sp|Q47ND5|COXX_THEFY Protoheme IX farnesyltransferase OS=Thermobifida fusca (strain YX) GN=ctaB PE=3 SV=1 9 203 1.0E-08
sp|Q057F2|CYOE_BUCCC Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=cyoE PE=3 SV=2 16 129 1.0E-08
sp|Q2W9D1|COXX1_MAGSA Protoheme IX farnesyltransferase 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ctaB1 PE=3 SV=2 25 206 1.0E-08
sp|Q6A7G0|COXX_PROAC Protoheme IX farnesyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ctaB PE=3 SV=2 15 228 2.0E-08
sp|Q3INR7|COXX2_NATPD Protoheme IX farnesyltransferase 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ctaB2 PE=3 SV=1 18 198 2.0E-08
sp|Q6KZG0|COXX2_PICTO Protoheme IX farnesyltransferase 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ctaB2 PE=3 SV=1 16 132 3.0E-08
sp|Q0I891|COXX_SYNS3 Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain CC9311) GN=ctaB PE=3 SV=1 1 211 8.0E-08
sp|A3MXJ5|COXX2_PYRCJ Protoheme IX farnesyltransferase 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=ctaB2 PE=3 SV=2 26 222 1.0E-07
sp|Q7VDD5|COXX_PROMA Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ctaB PE=3 SV=1 1 211 1.0E-07
sp|Q3IRC9|COXX1_NATPD Protoheme IX farnesyltransferase 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ctaB1 PE=3 SV=1 2 198 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 52 74 22
3 78 100 22
4 113 135 22
5 162 184 22
6 213 235 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081620
MSGVALSPLPTTIPVLLATAVGTTLCSASANALNQIQEVPFDAQMARTRNRPLCRRAISPAHASAFAIATGVAGP
ALLCVMVNPTTALLGAGNIALYAGAYTWMKRRSVANTWLGAVVGAVPPLMGWTACGGRLWPSIDYPIHTFLPFSE
VDLSMIDNPLGPVAFFALLFSWQFPHFMSLSHIVRGSYAQAGYRMLSVFNTSKTSAVSLRHAALLLPICSVLVPL
SGLTTWAFALTSLPANLICIRAAWNWWRNGGEKRARTV*
Coding >AgabiH97|081620
ATGTCCGGTGTCGCCCTTTCCCCACTCCCTACTACTATCCCCGTCCTTCTTGCCACGGCAGTCGGCACCACTCTC
TGCTCGGCCTCGGCCAACGCCCTCAACCAGATCCAGGAAGTCCCCTTTGACGCCCAGATGGCCCGCACCCGCAAC
CGTCCTCTCTGCCGCAGAGCCATCTCCCCTGCCCACGCCTCTGCTTTTGCCATAGCCACCGGTGTCGCCGGCCCG
GCACTCCTCTGCGTCATGGTCAATCCCACCACCGCTCTCCTCGGCGCAGGCAACATCGCCCTCTACGCCGGTGCC
TACACCTGGATGAAGCGCCGTTCCGTAGCCAACACCTGGCTCGGCGCCGTCGTCGGTGCCGTCCCTCCCCTCATG
GGCTGGACCGCGTGCGGAGGCAGACTCTGGCCCAGCATCGACTATCCCATTCATACCTTTTTGCCCTTTTCCGAG
GTCGACCTCTCGATGATTGACAACCCTCTCGGCCCCGTGGCCTTTTTTGCCCTCCTCTTCAGTTGGCAGTTTCCT
CACTTCATGTCCCTCTCTCACATCGTCAGAGGCTCTTACGCACAAGCTGGCTATCGCATGCTATCCGTATTCAAC
ACTAGTAAAACGAGTGCTGTATCTCTCAGACACGCCGCCCTCCTCCTCCCCATCTGCTCCGTCCTTGTCCCTCTC
TCTGGCCTCACCACCTGGGCCTTTGCTCTCACCTCACTCCCCGCCAACCTCATCTGCATCAGAGCCGCGTGGAAT
TGGTGGCGAAATGGCGGCGAAAAACGGGCAAGAACGGTATGA
Transcript >AgabiH97|081620
ATGTCCGGTGTCGCCCTTTCCCCACTCCCTACTACTATCCCCGTCCTTCTTGCCACGGCAGTCGGCACCACTCTC
TGCTCGGCCTCGGCCAACGCCCTCAACCAGATCCAGGAAGTCCCCTTTGACGCCCAGATGGCCCGCACCCGCAAC
CGTCCTCTCTGCCGCAGAGCCATCTCCCCTGCCCACGCCTCTGCTTTTGCCATAGCCACCGGTGTCGCCGGCCCG
GCACTCCTCTGCGTCATGGTCAATCCCACCACCGCTCTCCTCGGCGCAGGCAACATCGCCCTCTACGCCGGTGCC
TACACCTGGATGAAGCGCCGTTCCGTAGCCAACACCTGGCTCGGCGCCGTCGTCGGTGCCGTCCCTCCCCTCATG
GGCTGGACCGCGTGCGGAGGCAGACTCTGGCCCAGCATCGACTATCCCATTCATACCTTTTTGCCCTTTTCCGAG
GTCGACCTCTCGATGATTGACAACCCTCTCGGCCCCGTGGCCTTTTTTGCCCTCCTCTTCAGTTGGCAGTTTCCT
CACTTCATGTCCCTCTCTCACATCGTCAGAGGCTCTTACGCACAAGCTGGCTATCGCATGCTATCCGTATTCAAC
ACTAGTAAAACGAGTGCTGTATCTCTCAGACACGCCGCCCTCCTCCTCCCCATCTGCTCCGTCCTTGTCCCTCTC
TCTGGCCTCACCACCTGGGCCTTTGCTCTCACCTCACTCCCCGCCAACCTCATCTGCATCAGAGCCGCGTGGAAT
TGGTGGCGAAATGGCGGCGAAAAACGGGCAAGAACGGTATGA
Gene >AgabiH97|081620
ATGTCCGGTGTCGCCCTTTCCCCACTCCCTACTACTATCCCCGTCCTTCTTGCCACGGCAGTCGGCACCACTCTC
TGCTCGGCCTCGGCCAACGCCCTCAACCAGATCCAGGAAGTCCCCTTTGACGCCCAGATGGCCCGCACCCGCAAC
CGTCCTCTCTGCCGCAGAGCCATCTCCCCTGCCCACGCCTCTGCTTTTGCCATAGCCACCGGTGTCGCCGGCCCG
GCACTCCTCTGCGTCATGGTCAATCCCACCACCGCTCTCCTCGGCGCAGGCAACATCGCCCTCTACGCCGGTGCC
TACACCTGGATGAAGCGCCGTTCCGTAGCCAACACCTGGCTCGGCGCCGTCGTCGGTGCCGTCCCTCCCCTCATG
GGCTGGACCGCGTGCGGAGGCAGACTCTGGCCCAGCATCGACTATCCCATTCATACCTTTTTGCCCTTTTCCGAG
GTCGACCTCTCGATGATTGACAACCCTCTCGGCCCCGTGGCCTTTTTTGCCCTCCTCTTCAGTTGGCAGTTTCCT
CACTTCATGTCCCTCTCTCACATCGTCAGAGGCTCTTACGCACAAGCTGGCTATCGCATGCTATCCGTATTCAAC
ACTAGTAAAACGAGTGCTGTATCTCTCAGACACGCCGCCCTCCTCCTCCCCATCTGCTCCGTCCTTGTCCCTCTC
TCTGGCCTCACCACCTGGGCCTTTGCTCTCACCTCACTCCCCGCCAACCTCATCTGCATCAGAGCCGCGTGGAAT
TGGTGGCGAAATGGCGGCGAAAAACGGGCAAGAACGGTATTTCAACACAGCTTGTGGTACCTCCCCGTCGTCATG
GGTCTCATGATGTTCCATAAACAAGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail