Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081580
Gene name
Locationscaffold_5:882343..883568
Strand+
Gene length (bp)1225
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02840 Prp18 Prp18 domain 8.5E-62 188 327
PF08799 PRP4 pre-mRNA processing factor 4 (PRP4) like 2.5E-11 91 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GMH0|PRP18_DANRE Pre-mRNA-splicing factor 18 OS=Danio rerio GN=prpf18 PE=2 SV=1 1 329 1.0E-71
sp|Q99633|PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens GN=PRPF18 PE=1 SV=1 1 329 2.0E-70
sp|Q5RE03|PRP18_PONAB Pre-mRNA-splicing factor 18 OS=Pongo abelii GN=PRPF18 PE=2 SV=1 1 329 5.0E-70
sp|Q2HJ41|PRP18_BOVIN Pre-mRNA-splicing factor 18 OS=Bos taurus GN=PRPF18 PE=2 SV=1 1 329 5.0E-70
sp|Q9JKB8|PRP18_RAT Pre-mRNA-splicing factor 18 OS=Rattus norvegicus GN=Prpf18 PE=2 SV=1 1 329 6.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GMH0|PRP18_DANRE Pre-mRNA-splicing factor 18 OS=Danio rerio GN=prpf18 PE=2 SV=1 1 329 1.0E-71
sp|Q99633|PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens GN=PRPF18 PE=1 SV=1 1 329 2.0E-70
sp|Q5RE03|PRP18_PONAB Pre-mRNA-splicing factor 18 OS=Pongo abelii GN=PRPF18 PE=2 SV=1 1 329 5.0E-70
sp|Q2HJ41|PRP18_BOVIN Pre-mRNA-splicing factor 18 OS=Bos taurus GN=PRPF18 PE=2 SV=1 1 329 5.0E-70
sp|Q9JKB8|PRP18_RAT Pre-mRNA-splicing factor 18 OS=Rattus norvegicus GN=Prpf18 PE=2 SV=1 1 329 6.0E-70
sp|Q8BM39|PRP18_MOUSE Pre-mRNA-splicing factor 18 OS=Mus musculus GN=Prpf18 PE=1 SV=1 1 329 2.0E-69
sp|Q5EAV6|PRP18_XENLA Pre-mRNA-splicing factor 18 OS=Xenopus laevis GN=prpf18 PE=2 SV=1 1 335 2.0E-67
sp|O94406|PRP18_SCHPO Pre-mRNA-splicing factor 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp18 PE=3 SV=1 1 323 5.0E-33
sp|P33411|PRP18_YEAST Pre-mRNA-splicing factor 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP18 PE=1 SV=3 241 321 4.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0008380 RNA splicing Yes
GO:0090304 nucleic acid metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081580
MDSLKALVAEKRKAIDNDSARPAKYMRRGELERIKEEQEAKVREEKQLAQAAKKREEAEKAPKKPSVLSPPRDTE
SPSIESAFNISNEETIRRLRAKGQPIRLFGESDKDRRLRLRALELIEERSSEHQGGHNDFKKALEDVESVEKELQ
SKNGKGKKKEGESVNVGALDLNLVKTDPDKLYPLIYYALKKVLKEWEEAMDDRPDHVKRTNQGKLAAATQVQSAE
YLKPLFKNLRSRTLPPDMLARIAEIVHYMQKREYQKANDAYLRLSIGNAPWPIGVTMVGIHERSAREKISRDQVA
HVLNDEVSRKYIQSLKRLLTFSQTKYPPEDISQLMG*
Coding >AgabiH97|081580
ATGGACTCCCTCAAGGCTCTCGTCGCAGAAAAGCGTAAAGCTATCGACAATGACTCGGCCAGGCCTGCGAAATAC
ATGCGCAGAGGCGAACTCGAGCGCATCAAGGAGGAACAAGAGGCAAAGGTTCGCGAGGAGAAACAACTAGCGCAG
GCGGCAAAGAAACGAGAAGAGGCCGAGAAGGCCCCCAAGAAACCATCGGTACTTTCACCTCCTCGCGACACAGAG
TCTCCCAGTATAGAGTCGGCCTTCAACATCTCCAATGAAGAGACTATTCGCCGACTACGTGCCAAGGGCCAGCCC
ATTCGCTTGTTCGGCGAGTCAGACAAAGACCGTCGTCTAAGGCTTCGCGCCCTTGAACTCATCGAAGAGCGCAGC
AGTGAGCACCAGGGCGGTCACAATGATTTCAAAAAGGCTCTGGAGGATGTGGAGAGCGTCGAAAAAGAGTTGCAG
AGCAAGAACGGCAAGGGCAAAAAGAAAGAGGGTGAATCCGTCAATGTAGGCGCCCTCGACCTCAACCTCGTCAAG
ACGGACCCAGACAAACTCTACCCCCTCATCTACTATGCCCTCAAGAAGGTGCTCAAAGAGTGGGAAGAAGCAATG
GACGATCGACCAGACCACGTCAAACGAACCAATCAGGGAAAACTCGCCGCTGCTACACAAGTTCAGTCAGCAGAA
TACCTGAAACCTCTTTTCAAAAACTTACGGTCAAGGACTCTCCCTCCCGACATGCTTGCCCGCATCGCCGAAATA
GTACATTACATGCAAAAGAGAGAGTATCAAAAAGCCAACGATGCCTATCTTCGGCTTTCAATAGGAAACGCTCCA
TGGCCTATTGGTGTAACCATGGTTGGTATTCATGAACGTTCTGCACGGGAAAAGATATCGAGAGATCAAGTGGCA
CATGTTTTGAACGACGAAGTCAGTCGGAAATATATTCAAAGCCTCAAACGATTGCTCACATTTTCTCAAACAAAA
TACCCGCCAGAGGATATCTCGCAGCTCATGGGTTAA
Transcript >AgabiH97|081580
ATGGACTCCCTCAAGGCTCTCGTCGCAGAAAAGCGTAAAGCTATCGACAATGACTCGGCCAGGCCTGCGAAATAC
ATGCGCAGAGGCGAACTCGAGCGCATCAAGGAGGAACAAGAGGCAAAGGTTCGCGAGGAGAAACAACTAGCGCAG
GCGGCAAAGAAACGAGAAGAGGCCGAGAAGGCCCCCAAGAAACCATCGGTACTTTCACCTCCTCGCGACACAGAG
TCTCCCAGTATAGAGTCGGCCTTCAACATCTCCAATGAAGAGACTATTCGCCGACTACGTGCCAAGGGCCAGCCC
ATTCGCTTGTTCGGCGAGTCAGACAAAGACCGTCGTCTAAGGCTTCGCGCCCTTGAACTCATCGAAGAGCGCAGC
AGTGAGCACCAGGGCGGTCACAATGATTTCAAAAAGGCTCTGGAGGATGTGGAGAGCGTCGAAAAAGAGTTGCAG
AGCAAGAACGGCAAGGGCAAAAAGAAAGAGGGTGAATCCGTCAATGTAGGCGCCCTCGACCTCAACCTCGTCAAG
ACGGACCCAGACAAACTCTACCCCCTCATCTACTATGCCCTCAAGAAGGTGCTCAAAGAGTGGGAAGAAGCAATG
GACGATCGACCAGACCACGTCAAACGAACCAATCAGGGAAAACTCGCCGCTGCTACACAAGTTCAGTCAGCAGAA
TACCTGAAACCTCTTTTCAAAAACTTACGGTCAAGGACTCTCCCTCCCGACATGCTTGCCCGCATCGCCGAAATA
GTACATTACATGCAAAAGAGAGAGTATCAAAAAGCCAACGATGCCTATCTTCGGCTTTCAATAGGAAACGCTCCA
TGGCCTATTGGTGTAACCATGGTTGGTATTCATGAACGTTCTGCACGGGAAAAGATATCGAGAGATCAAGTGGCA
CATGTTTTGAACGACGAAGTCAGTCGGAAATATATTCAAAGCCTCAAACGATTGCTCACATTTTCTCAAACAAAA
TACCCGCCAGAGGATATCTCGCAGCTCATGGGTTAA
Gene >AgabiH97|081580
ATGGACTCCCTCAAGGCTCTCGTCGCAGAAAAGCGTAAAGCTATCGACAATGACTCGGCCAGGCCTGCGAAATAC
ATGCGCAGAGGCGAACTCGAGCGCATCAAGGAGGAACAAGAGGCAAAGGTTCGCGAGGAGAAACAACTAGCGCAG
GCGGCAAAGAAACGAGAAGAGGCCGAGAAGGCCCCCAAGAAAGTGAGCCTGACCGATATTCTGTTCTCAATTTAG
GACCCTAATTTCGCTGTTGGAGAACAGCCATCGGTACTTTCACCTCCTCGCGACACAGAGTCTCCCAGTATAGAG
TCGGCCTTCAACATCTCCAATGAAGAGACTATTCGCCGACTACGTGCCAAGGGCCAGCCCATTCGCTTGTTCGGC
GAGTCAGACAAAGACCGTCGTCTAAGGCTTCGCGCCCTTGAACTCATCGAAGAGCGCAGCAGTGAGCACCAGGGC
GGTCACAATGATTTCAAAAAGGCTCTGGAGGATGTGGAGAGCGTCGAAAAAGAGTTGCAGAGCAAGAACGGCAAG
GGCAAAAAGAAAGAGGGTGAATCCGTCAATGTAGGCGCCCTCGACCTCAACCTCGTCAAGACGGACCCAGACAAA
CTCTACCCCCTCATCTACTATGCCCTCAAGAAGGTGCTCAAAGAGTGGGAAGAAGCAATGGACGATCGACCAGAC
CACGTCAAACGAACCAATCAGGGAAAACTCGCCGCTGCTACACAAGTTCAGTCAGCAGAATACCTGAAACCTCTT
TTCAAAAACTTACGGTCAAGGGTATGTATTATTATTACTTAGCAATTTAAACCCTGCCTGATTGTCTTGTAGACT
CTCCCTCCCGACATGCTTGCCCGCATCGCCGAAATAGTACATTACATGCAAAAGAGAGAGTATCAAAAAGCCAAC
GATGCCTATCTTCGGCTTTCAATAGGAAACGCTCCATGGCCTATTGGTGTAACCATGGTTGGGTATGTCAGAATG
GCTCATCTTTAAAATCTATCATATTAACCACACCGTAGTATTCATGAACGTTCTGCACGGGAAAAGATATCGAGA
GATCAAGTGGCACATGTTTTGAACGACGAAGTCAGTCGGAAATATATTCAAAGCCTCAAACGGTATGTCTCTTGC
TTCGTAACTTACTTTTAACTCAACTTCGCATAATCGCAGATTGCTCACATTTTCTCAAACAAAATACCCGCCAGA
GGATATCTCGCAGCTCATGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail