Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081470
Gene name
Locationscaffold_5:861581..865923
Strand+
Gene length (bp)4342
Transcript length (bp)3897
Coding sequence length (bp)3897
Protein length (aa) 1299

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 2.8E-12 492 589

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4476 0.9036 0.0383 0.042 0.07 0.0136 0.0341 0.008 0.0202 0.0142

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup2674
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|081470
Agaricus bisporus var bisporus H97 AgabiH97|081470 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|65_13

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081470
MIPNFSNPALLQQQQQQQQHPQQSQHPQHQQQPDQHAAYQDQNRLWQQQAQFRPRSGMDINQQPQQQQQQQPQQV
QDMFRARHGSQNQPMGPQQPMPQFGLGMSPAQMPNAGAMKPLPSNQQQPFSDASAAQSQPSHMQPAGFANMGSMP
NQNPGLNAASIPQRNSNILAMQNGAMGKQLELMLAQSANNAFHPAKLNQQHQQNQQVQQQQQQPSQQQVQSEMFS
PALSGDALRRPSPSHPPNLPPQMQGSLQGPQQHPVPGVLHPSAMPQRRNQAALQEITERLKAARQNVMSSEAELR
AVMNQLHTQPGEVTQNIQGMQNDLKLKQEILQQLQRQQQAFLHDGAIANNLARLGPNNVPGQSPWAPQNSQSQNF
ENGGGMGRGGAHLQNPHQPGQQPPNGMQPNSALQQAPNNHLMASGGVPRQGPTPNPPGIQPPQQLGSPFPGQMNV
PANMANKPNFPLGAYMGANPAAAAAAMHQRTLNSLGFPPPLEKSKFNSTLPGFLQKRSIKIDPALLRLNDQQIDL
ANLHALVISEGGYNKVHENGLWDVIGGRMGFVNFPGSDHEPAKSGPVVAQNLAHVYREYLLDLETAYLRTWIANA
HARMNNPGMQHPGGPGGLPNGMAANGQQPRFSPQLLQYAHMSTAELRHRGVPENVIAMVDQVRPQLQRTLMEQKR
FQQQGAMINEAGQQNGSAAMMLRQQMMKHPMMNGAGGMDARFNPFHAQYPQRNLEMTKNAMEAINRMKEDCKKGP
QLARFMQANIEIPYDQQAEFNRLLDATYRQAQDLDQKLHLLHVILPSCTQRVIIISNIVATQRQLKSTSQPRYIL
SLDLLRNLASELQKIVEMFTTAHMQKQYARMQPPGQQHQLAQLGQVPNQPPQPPGMSNHPGPHPHQQPPPSGPNN
MNGTAHSPPGSNNMLNLRHSPMQQPAHQQHPQPPQQQQQQQPMQIPPQQGLQVSQQPQAPSPSHMPSNRGASINL
QAPPHNKKKAQNAPTPNTAPSPAAAASTPAPTNAPTPTAAASSPAAPKSPKGKAKAKQPGRRKMSTAPNPAPTPS
SAPVQAPAQAPPEAAQHQPPTTNGSGKRPREEDAPSGNMAPSPAGGSNAVVDQPSPPKRSKLEWGDGSQSEELQQ
KKAQVENVKTEEDTSQLLEDIIKIVGGDPVRDNNGFAELSMLLKGYTQPGSADDLASFPSLEPPLMMKDDLEQYF
DFSLGGEDDDSKTPELLSSSSTTDTSPGSNAGNEPTSEGAAAQISNEIKNEESLDFTPLTHLGLWSGVDGGESAY
YQTSDWKWDNTMGTQDPWAISTS*
Coding >AgabiH97|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTTCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCTCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAGGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGCCTCAACAAGTC
CAGGACATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGT
CTCGGCATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCCCTTCCCTCAAATCAACAACAACCCTTT
TCCGACGCCTCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCC
AACCAGAATCCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCC
ATGGGCAAGCAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAACGCTTTTCACCCGGCAAAGCTGAATCAGCAG
CACCAACAGAACCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCT
CCCGCTCTCTCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGC
TCTCTACAGGGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAG
GCCGCCCTTCAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGC
GCGGTCATGAATCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAG
CTCAAGCAGGAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATTGCCAATAAC
CTTGCTCGTCTGGGTCCAAACAATGTCCCCGGCCAGTCGCCATGGGCCCCTCAGAATAGCCAATCTCAGAACTTT
GAGAATGGTGGAGGTATGGGTCGCGGCGGTGCGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAAC
GGCATGCAACCCAACTCTGCCCTTCAACAAGCACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAA
GGTCCTACGCCAAATCCACCTGGCATTCAGCCCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTT
CCTGCCAACATGGCCAACAAACCCAATTTCCCATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCCGCTGCA
GCAATGCACCAGCGTACTCTAAACAGTCTTGGATTTCCTCCTCCCCTCGAGAAAAGCAAGTTTAATTCAACGCTG
CCCGGGTTTCTACAGAAACGGAGCATCAAGATCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTC
GCCAATCTTCACGCGCTTGTCATTAGTGAAGGAGGATACAATAAAGTCCATGAGAACGGGCTCTGGGATGTTATT
GGCGGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGCTAAATCCGGCCCGGTCGTCGCTCAG
AACCTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTATCTCCGTACTTGGATAGCCAACGCA
CATGCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGGCCTACCGAACGGCATGGCTGCTAAT
GGACAACAACCCAGGTTCAGTCCCCAACTGTTGCAGTACGCGCACATGTCCACAGCTGAACTGCGTCATCGTGGT
GTCCCCGAAAACGTGATCGCTATGGTTGACCAAGTCCGGCCTCAGTTGCAGAGGACGCTCATGGAGCAAAAGAGG
TTTCAACAACAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGGATCTGCTGCCATGATGCTACGTCAACAG
ATGATGAAGCATCCCATGATGAACGGTGCTGGTGGCATGGACGCTCGTTTTAATCCATTCCATGCGCAATATCCC
CAACGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCGGATGAAGGAAGACTGTAAAAAGGGTCCG
CAACTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAATTTAATAGACTGCTTGAC
GCCACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATACTACCCTCATGTACGCAG
AGAGTTATCATTATTTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTG
AGCCTGGACCTACTTCGGAATCTGGCTTCGGAACTTCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAG
AAACAATACGCAAGAATGCAACCGCCCGGGCAACAGCATCAACTTGCTCAACTGGGACAAGTTCCTAATCAGCCG
CCGCAACCTCCCGGGATGTCAAACCATCCCGGCCCTCACCCCCATCAACAACCCCCACCTTCCGGGCCCAACAAT
ATGAACGGAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCT
GCTCATCAACAACATCCCCAACCTCCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGG
CTGCAAGTTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGCGCTTCGATAAACCTG
CAAGCGCCACCCCACAACAAAAAGAAGGCTCAGAATGCTCCGACTCCTAATACCGCTCCCTCTCCCGCCGCCGCT
GCTTCGACGCCTGCGCCTACTAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCCGCGGCGCCCAAGTCGCCC
AAGGGTAAGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGC
TCTGCTCCTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGCGCAGCACCAGCCTCCGACTACGAACGGTAGT
GGGAAGCGACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTT
GTTGATCAACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAG
AAGAAGGCACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTT
GGGGGAGACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTCCTGAAAGGATACACTCAACCTGGT
TCTGCTGATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTT
GACTTTTCGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAGCTACTGTCTTCATCTTCGACGACTGACACG
AGTCCTGGGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAAT
GAAGAGTCGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTAT
TATCAGACCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA
Transcript >AgabiH97|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTTCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCTCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAGGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGCCTCAACAAGTC
CAGGACATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGT
CTCGGCATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCCCTTCCCTCAAATCAACAACAACCCTTT
TCCGACGCCTCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCC
AACCAGAATCCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCC
ATGGGCAAGCAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAACGCTTTTCACCCGGCAAAGCTGAATCAGCAG
CACCAACAGAACCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCT
CCCGCTCTCTCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGC
TCTCTACAGGGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAG
GCCGCCCTTCAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGC
GCGGTCATGAATCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAG
CTCAAGCAGGAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATTGCCAATAAC
CTTGCTCGTCTGGGTCCAAACAATGTCCCCGGCCAGTCGCCATGGGCCCCTCAGAATAGCCAATCTCAGAACTTT
GAGAATGGTGGAGGTATGGGTCGCGGCGGTGCGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAAC
GGCATGCAACCCAACTCTGCCCTTCAACAAGCACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAA
GGTCCTACGCCAAATCCACCTGGCATTCAGCCCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTT
CCTGCCAACATGGCCAACAAACCCAATTTCCCATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCCGCTGCA
GCAATGCACCAGCGTACTCTAAACAGTCTTGGATTTCCTCCTCCCCTCGAGAAAAGCAAGTTTAATTCAACGCTG
CCCGGGTTTCTACAGAAACGGAGCATCAAGATCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTC
GCCAATCTTCACGCGCTTGTCATTAGTGAAGGAGGATACAATAAAGTCCATGAGAACGGGCTCTGGGATGTTATT
GGCGGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGCTAAATCCGGCCCGGTCGTCGCTCAG
AACCTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTATCTCCGTACTTGGATAGCCAACGCA
CATGCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGGCCTACCGAACGGCATGGCTGCTAAT
GGACAACAACCCAGGTTCAGTCCCCAACTGTTGCAGTACGCGCACATGTCCACAGCTGAACTGCGTCATCGTGGT
GTCCCCGAAAACGTGATCGCTATGGTTGACCAAGTCCGGCCTCAGTTGCAGAGGACGCTCATGGAGCAAAAGAGG
TTTCAACAACAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGGATCTGCTGCCATGATGCTACGTCAACAG
ATGATGAAGCATCCCATGATGAACGGTGCTGGTGGCATGGACGCTCGTTTTAATCCATTCCATGCGCAATATCCC
CAACGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCGGATGAAGGAAGACTGTAAAAAGGGTCCG
CAACTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAATTTAATAGACTGCTTGAC
GCCACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATACTACCCTCATGTACGCAG
AGAGTTATCATTATTTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTG
AGCCTGGACCTACTTCGGAATCTGGCTTCGGAACTTCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAG
AAACAATACGCAAGAATGCAACCGCCCGGGCAACAGCATCAACTTGCTCAACTGGGACAAGTTCCTAATCAGCCG
CCGCAACCTCCCGGGATGTCAAACCATCCCGGCCCTCACCCCCATCAACAACCCCCACCTTCCGGGCCCAACAAT
ATGAACGGAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCT
GCTCATCAACAACATCCCCAACCTCCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGG
CTGCAAGTTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGCGCTTCGATAAACCTG
CAAGCGCCACCCCACAACAAAAAGAAGGCTCAGAATGCTCCGACTCCTAATACCGCTCCCTCTCCCGCCGCCGCT
GCTTCGACGCCTGCGCCTACTAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCCGCGGCGCCCAAGTCGCCC
AAGGGTAAGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGC
TCTGCTCCTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGCGCAGCACCAGCCTCCGACTACGAACGGTAGT
GGGAAGCGACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTT
GTTGATCAACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAG
AAGAAGGCACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTT
GGGGGAGACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTCCTGAAAGGATACACTCAACCTGGT
TCTGCTGATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTT
GACTTTTCGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAGCTACTGTCTTCATCTTCGACGACTGACACG
AGTCCTGGGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAAT
GAAGAGTCGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTAT
TATCAGACCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA
Gene >AgabiH97|081470
ATGATTCCCAACTTTAGCAATCCCGCCCTCCTTCAGCAGCAGCAGCAACAACAACAGCACCCCCAGCAATCCCAG
CACCCTCAGCACCAGCAGCAGCCAGACCAACACGCCGCTTATCAAGACCAAAACAGGCTATGGCAGCAGCAGGCT
CAGTTCAGACCTCGTAGTGGCATGGACATCAACCAGCAGCCCCAGCAGCAGCAGCAGCAGCAGCCTCAACAAGTG
AGCCTTTCCCAACCCCACTTGCCCTCCCCACCCCTCTCTCTCCCACATACCTCTCTCCTTCCCTACCCCGCGGCC
ACTAACCCTTTCCTTGTCGTGGGAGCTTCTTCCTCCTGATGATCATCGTTCTTACCTCATTCACAGGTCCAGGAC
ATGTTCAGAGCTCGCCACGGTTCCCAGAACCAGCCGATGGGTCCTCAGCAGCCCATGCCTCAGTTCGGTCTCGGC
ATGTCCCCCGCTCAGATGCCCAACGCTGGTGCTATGAAGCCCCTTCCCTCAAATCAACAACAACCCTTTTCCGAC
GCCTCTGCCGCGCAGTCCCAGCCGTCACACATGCAACCTGCCGGCTTTGCTAACATGGGCTCTATGCCCAACCAG
AATCCCGGCCTTAATGCCGCTTCTATTCCGCAACGTAATTCCAATATCCTCGCCATGCAAAACGGAGCCATGGGC
AAGCAGCTCGAACTCATGCTCGCGCAGTCCGCCAATAACGCTTTTCACCCGGCAAAGCTGAATCAGCAGCACCAA
CAGAACCAGCAGGTCCAGCAGCAGCAGCAGCAGCCGTCGCAGCAACAAGTACAAAGTGAGATGTTCTCTCCCGCT
CTCTCCGGCGATGCTCTCCGACGTCCCTCCCCTTCCCACCCTCCTAACCTTCCTCCCCAAATGCAAGGCTCTCTA
CAGGGCCCCCAGCAACATCCCGTTCCCGGTGTCCTCCATCCTTCCGCAATGCCGCAGCGTCGCAATCAGGCCGCC
CTTCAAGAGATTACTGAGCGGTTAAAAGCCGCTCGTCAGAACGTCATGTCCAGTGAGGCGGAGCTTCGCGCGGTC
ATGAATCAGCTTCATACGCAGCCCGGAGAGGTCACCCAGAACATTCAGGGCATGCAAAACGATCTCAAGCTCAAG
CAGGAAATCCTACAACAGCTACAACGGCAGCAGCAAGCCTTTTTGCATGACGGTGCTATGTACGTGTTGGTCCCT
ACATCGCCCTGCTTTTCATACTAAATTTTTAAACCAGTGCCAATAACCTTGCTCGTCTGGGTCCAAACAATGTCC
CCGGCCAGTCGCCATGGGCCCCTCAGAATAGCCAATCTCAGAACTTTGAGAATGGTGGAGGTATGGGTCGCGGCG
GTGCGCATCTTCAGAACCCTCATCAACCGGGCCAACAACCGCCCAACGGCATGCAACCCAACTCTGCCCTTCAAC
AAGCACCCAACAACCACCTCATGGCGTCTGGCGGCGTTCCACGGCAAGGTCCTACGCCAAATCCACCTGGCATTC
AGCCCCCCCAGCAACTGGGTAGCCCTTTCCCAGGCCAAATGAACGTTCCTGCCAACATGGCCAACAAACCCAATT
TCCCATTGGGTGCGTATATGGGCGCCAATCCGGCGGCTGCCGCTGCAGCAATGCACCAGCGTACTCTAAACAGTC
TTGGATTTCCTCCTCCCCTCGAGAAAAGCAAGTTTAATTCAACGCTGCCCGGGTTTCTACAGAAACGGAGCATCA
AGATCGATCCGGCCTTGTTAAGGCTCAATGATCAACAAATCGATCTCGCCAATCTTCACGCGCTTGTCATTAGTG
AAGGAGGATACAATAAAGTAGGTTTTCATCCCCGCGGGGAACTGTGGTACTGACCGGATGTCATCTCTAGGTCCA
TGAGAACGGGCTCTGGGATGTTATTGGCGGAAGGATGGGTTTTGTCAACTTTCCCGGATCGGATCACGAGCCCGC
TAAATCCGGCCCGGTCGTCGCTCAGAACCTCGCACATGTGTACCGCGAGTATCTCCTAGATTTGGAAACTGCCTA
TCTCCGTACTTGGATAGCCAACGCACATGCGAGAATGAACAACCCGGGAATGCAACATCCTGGTGGCCCTGGTGG
CCTACCGAACGGCATGGCTGCTAATGGACAACAACCCAGGTTCAGTCCCCAACTGTTGCAGTACGCGCACATGTC
CACAGCTGAACTGCGTCATCGTGGTGTCCCCGAAAACGTGATCGCTATGGTTGACCAAGTCCGGCCTCAGTTGCA
GAGGACGCTCATGGAGCAAAAGAGGTTTCAACAACAGGTGCGCATGAACGCTCGGAATGGGCCTGGAATGGCTGG
TGTACCCGTTGATGCTAACGGGATGCAACCTCCAAACCAGGGCGCCATGATCAACGAAGCCGGTCAACAGAATGG
ATCTGCTGCCATGATGCTACGTCAACAGATGATGAAGCATCCCATGATGAACGGTGCTGGTGGCATGGACGCTCG
TTTTAATCCATTCCATGCGCAATATCCCCAACGTAACCTCGAGATGACCAAGAACGCTATGGAGGCGATTAATCG
GATGAAGGAAGACTGTAAAAAGGGTCAGTTCCCACCTTTGTGACTGGTTGCTTGATCCAGCTTGATAACGGGGCC
ATTTCCATCTAGGTCCGCAACTTGCTCGTTTCATGCAAGCAAACATCGAGATACCATATGACCAACAAGCCGAAT
TTAATAGACTGCTTGACGCCACTTATCGTCAAGCACAAGATTTAGACCAAAAACTGCATCTTCTGCATGTGATAC
TACCCTCATGTACGCAGAGAGTTATCATTATTGTACGTCTTTTCCATTTATAGTTTCGTCTGTTGTACTAACGAA
TCACCCAAAGTCCAACATTGTCGCAACTCAAAGGCAATTGAAATCGACTTCTCAGCCCCGGTACATCTTGAGCCT
GGACCTACTTCGGAATCTGGCTTCGGAACTTCAAAAAATTGTAGAAATGTTTACGACCGCACATATGCAGAAACA
ATACGCAAGAATGCAACCGCCCGGGCAACAGCATCAACTTGCTCAACTGGGACAAGTTCCTAATCAGCCGCCGCA
ACCTCCCGGGATGTCAAACCATCCCGGCCCTCACCCCCATCAACAACCCCCACCTTCCGGGCCCAACAATATGAA
CGGAACGGCGCATTCGCCTCCTGGATCTAATAATATGCTGAATCTTCGTCATTCTCCTATGCAACAACCTGCTCA
TCAACAACATCCCCAACCTCCTCAGCAACAACAGCAGCAGCAGCCGATGCAAATACCCCCTCAGCAGGGGCTGCA
AGTTTCTCAACAACCTCAGGCTCCATCTCCTTCGCATATGCCATCAAATAGAGGCGCTTCGATAAACCTGCAAGC
GCCACCCCACAACAAAAAGAAGGCTCAGAATGCTCCGACTCCTAATACCGCTCCCTCTCCCGCCGCCGCTGCTTC
GACGCCTGCGCCTACTAATGCGCCTACACCGACCGCTGCCGCTTCTTCCCCCGCGGCGCCCAAGTCGCCCAAGGG
TAAGGCCAAAGCCAAGCAGCCGGGCAGACGAAAGATGTCGACGGCGCCGAATCCCGCTCCCACACCTAGCTCTGC
TCCTGTTCAAGCGCCTGCTCAAGCGCCTCCTGAAGCGGCGCAGCACCAGCCTCCGACTACGAACGGTAGTGGGAA
GCGACCACGTGAGGAGGATGCTCCGAGTGGGAACATGGCACCTAGTCCTGCCGGAGGATCTAATGCAGTTGTTGA
TCAACCTTCGCCACCCAAGCGTTCCAAACTGGAATGGGGAGACGGGTCTCAGTCAGAAGAATTGCAGCAGAAGAA
GGCACAGGTTGAGAACGTCAAGACGGAGGAGGATACGAGTCAGCTGTTGGAGGATATTATCAAGATTGTTGGGGG
AGACCCTGTACGGGATAACAACGGGTTTGCAGAACTTTCGATGCTCCTGAAAGGATACACTCAACCTGGTTCTGC
TGATGACCTGGCTTCGTTCCCGTCTCTTGAGCCTCCGTTGATGATGAAAGACGATCTAGAGCAGTACTTTGACTT
TTCGTTGGGAGGCGAAGATGACGATTCAAAGACACCTGAGCTACTGTCTTCATCTTCGACGACTGACACGAGTCC
TGGGTCTAATGCGGGTAATGAGCCTACATCGGAAGGAGCGGCAGCACAGATATCCAACGAAATTAAAAATGAAGA
GTCGCTCGACTTTACGCCTCTTACGCATCTTGGACTATGGAGTGGAGTGGATGGAGGAGAGTCGGCTTATTATCA
GACCTCCGACTGGAAATGGGATAATACAATGGGAACACAGGATCCTTGGGCAATCTCCACTTCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail