Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081460
Gene name
Locationscaffold_5:859703..861089
Strand+
Gene length (bp)1386
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09335 SNARE_assoc SNARE associated Golgi protein 1.1E-11 148 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJD5|TM41B_HUMAN Transmembrane protein 41B OS=Homo sapiens GN=TMEM41B PE=1 SV=1 32 313 1.0E-37
sp|Q5RBZ8|TM41B_PONAB Transmembrane protein 41B OS=Pongo abelii GN=TMEM41B PE=2 SV=1 32 313 8.0E-37
sp|Q5ZIL6|TM41B_CHICK Transmembrane protein 41B OS=Gallus gallus GN=TMEM41B PE=2 SV=1 73 313 1.0E-36
sp|Q8K1A5|TM41B_MOUSE Transmembrane protein 41B OS=Mus musculus GN=Tmem41b PE=1 SV=1 94 313 2.0E-36
sp|A1A5V7|TM41B_DANRE Transmembrane protein 41B OS=Danio rerio GN=tmem41b PE=2 SV=1 31 313 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJD5|TM41B_HUMAN Transmembrane protein 41B OS=Homo sapiens GN=TMEM41B PE=1 SV=1 32 313 1.0E-37
sp|Q5RBZ8|TM41B_PONAB Transmembrane protein 41B OS=Pongo abelii GN=TMEM41B PE=2 SV=1 32 313 8.0E-37
sp|Q5ZIL6|TM41B_CHICK Transmembrane protein 41B OS=Gallus gallus GN=TMEM41B PE=2 SV=1 73 313 1.0E-36
sp|Q8K1A5|TM41B_MOUSE Transmembrane protein 41B OS=Mus musculus GN=Tmem41b PE=1 SV=1 94 313 2.0E-36
sp|A1A5V7|TM41B_DANRE Transmembrane protein 41B OS=Danio rerio GN=tmem41b PE=2 SV=1 31 313 3.0E-36
sp|Q5FVN2|TM41B_RAT Transmembrane protein 41B OS=Rattus norvegicus GN=Tmem41b PE=2 SV=1 94 313 8.0E-36
sp|Q5U4K5|TM41B_XENLA Transmembrane protein 41B OS=Xenopus laevis GN=tmem41b PE=2 SV=1 57 313 8.0E-36
sp|Q9VX39|TM41_DROME Transmembrane protein 41 homolog OS=Drosophila melanogaster GN=stas PE=2 SV=2 80 313 3.0E-34
sp|A4II98|TM41B_XENTR Transmembrane protein 41B OS=Xenopus tropicalis GN=tmem41b PE=2 SV=1 57 313 4.0E-34
sp|Q8MXN7|TM41_DICDI Transmembrane protein 41 homolog OS=Dictyostelium discoideum GN=DDB_G0275543 PE=3 SV=2 90 301 6.0E-30
sp|O62126|TM41_CAEEL Transmembrane protein 41 homolog OS=Caenorhabditis elegans GN=tag-175 PE=3 SV=1 94 305 2.0E-29
sp|Q96HV5|TM41A_HUMAN Transmembrane protein 41A OS=Homo sapiens GN=TMEM41A PE=1 SV=1 61 317 4.0E-27
sp|Q08D99|TM41A_BOVIN Transmembrane protein 41A OS=Bos taurus GN=TMEM41A PE=2 SV=1 98 317 7.0E-27
sp|Q9D8U2|TM41A_MOUSE Transmembrane protein 41A OS=Mus musculus GN=Tmem41a PE=2 SV=1 95 317 1.0E-25
sp|Q8L586|Y4958_ARATH Uncharacterized membrane protein At4g09580 OS=Arabidopsis thaliana GN=At4g09580 PE=1 SV=1 30 281 4.0E-25
sp|Q502G2|T41AA_DANRE Transmembrane protein 41A-A OS=Danio rerio GN=tmem41aa PE=2 SV=1 105 321 9.0E-24
sp|Q6NV38|T41AB_DANRE Transmembrane protein 41A-B OS=Danio rerio GN=tmem41ab PE=2 SV=1 98 321 3.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 132 154 22
3 174 196 22
4 245 267 22
5 282 304 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081460
MPPPLLVLDPHLGTSHRNDSMYTLNTVADDDDSSSRRSSNTSPLLSSDSQSYGTTPNSQSRPSSGKVILHATLKM
ACIFLVSTLLLGGVLWIALPTLDDADRPLLRIPKSFSQLQDLNGLLKKYRDIYPYRIVVCYVITYLFLQAFSLPG
SMYLSILGGAVWGVTRALPLTCCCVATGATLCYLISAALGPALLTIPKWKAVLDKWADKIQANKENMISFLIVLR
IAPLPPHWVVNVLCPHVGIGIVPFWISTALGILGVTVIHTTIGGGLDDMTSSDDFHLISWRNFFTLAAIAVGVLI
PVGLRYWFRQRVQDIEEQGGLMAEPIEDPYVDDPEDRILAVGPPGLGLAKKAGERLLLRRDDDESSLESFYDEDE
DIILEAGPLIPDKAGEERLLVDVGSSSSSSLDSVINLTPGATHPLARR*
Coding >AgabiH97|081460
ATGCCGCCCCCTCTGCTCGTCCTTGACCCTCACCTAGGAACCTCGCATCGAAACGATTCCATGTACACCCTCAAC
ACCGTGGCCGACGACGACGACTCCAGCTCTCGCCGCTCCTCCAACACTTCTCCTCTCCTCTCCTCCGACTCCCAG
TCTTATGGTACCACTCCAAACTCTCAGTCCCGACCCTCCTCGGGAAAGGTCATTCTCCATGCGACGCTTAAAATG
GCCTGTATCTTTCTCGTCAGCACGCTCCTACTGGGCGGCGTCCTCTGGATCGCACTCCCCACCCTTGACGACGCG
GACCGCCCACTGCTGCGGATACCCAAGTCCTTCTCGCAGCTTCAGGACCTGAACGGCTTGCTCAAGAAATACCGC
GACATCTATCCTTACAGGATCGTCGTTTGCTATGTTATCACCTACCTCTTTCTACAGGCATTTTCGTTGCCCGGA
TCGATGTACCTGTCCATCCTTGGTGGTGCTGTATGGGGCGTGACACGGGCTCTCCCTTTAACCTGTTGCTGCGTT
GCAACGGGAGCAACGCTTTGCTATCTCATTTCAGCGGCACTCGGACCTGCTCTTCTGACTATCCCAAAGTGGAAA
GCTGTGCTGGACAAGTGGGCTGATAAAATTCAAGCGAACAAGGAAAACATGATTTCGTTCCTCATCGTGCTTCGG
ATTGCACCTTTGCCTCCTCATTGGGTGGTCAATGTTTTATGTCCCCATGTCGGCATCGGCATTGTCCCATTTTGG
ATTAGCACAGCACTCGGCATTCTCGGAGTGACGGTGATACACACAACGATTGGTGGTGGATTGGACGACATGACG
AGCTCTGACGATTTCCATCTGATCAGCTGGCGGAATTTCTTCACTCTGGCAGCTATTGCTGTCGGGGTGTTAATA
CCTGTTGGGCTGCGGTATTGGTTTCGGCAGAGGGTCCAGGACATTGAAGAGCAAGGCGGACTGATGGCAGAACCG
ATAGAAGACCCGTATGTTGATGACCCAGAGGACAGAATTTTGGCGGTGGGTCCGCCCGGACTCGGGTTGGCCAAG
AAGGCGGGAGAAAGGTTATTACTGAGAAGAGATGATGACGAGAGTAGTCTAGAGAGCTTCTATGACGAGGACGAG
GACATCATTTTGGAAGCTGGACCCCTGATACCCGACAAGGCGGGAGAGGAGCGGTTGCTTGTGGACGTGGGGAGT
TCGAGTAGTTCGAGCTTGGACTCGGTGATCAATCTGACACCTGGGGCGACGCATCCTCTCGCTCGCCGATGA
Transcript >AgabiH97|081460
ATGCCGCCCCCTCTGCTCGTCCTTGACCCTCACCTAGGAACCTCGCATCGAAACGATTCCATGTACACCCTCAAC
ACCGTGGCCGACGACGACGACTCCAGCTCTCGCCGCTCCTCCAACACTTCTCCTCTCCTCTCCTCCGACTCCCAG
TCTTATGGTACCACTCCAAACTCTCAGTCCCGACCCTCCTCGGGAAAGGTCATTCTCCATGCGACGCTTAAAATG
GCCTGTATCTTTCTCGTCAGCACGCTCCTACTGGGCGGCGTCCTCTGGATCGCACTCCCCACCCTTGACGACGCG
GACCGCCCACTGCTGCGGATACCCAAGTCCTTCTCGCAGCTTCAGGACCTGAACGGCTTGCTCAAGAAATACCGC
GACATCTATCCTTACAGGATCGTCGTTTGCTATGTTATCACCTACCTCTTTCTACAGGCATTTTCGTTGCCCGGA
TCGATGTACCTGTCCATCCTTGGTGGTGCTGTATGGGGCGTGACACGGGCTCTCCCTTTAACCTGTTGCTGCGTT
GCAACGGGAGCAACGCTTTGCTATCTCATTTCAGCGGCACTCGGACCTGCTCTTCTGACTATCCCAAAGTGGAAA
GCTGTGCTGGACAAGTGGGCTGATAAAATTCAAGCGAACAAGGAAAACATGATTTCGTTCCTCATCGTGCTTCGG
ATTGCACCTTTGCCTCCTCATTGGGTGGTCAATGTTTTATGTCCCCATGTCGGCATCGGCATTGTCCCATTTTGG
ATTAGCACAGCACTCGGCATTCTCGGAGTGACGGTGATACACACAACGATTGGTGGTGGATTGGACGACATGACG
AGCTCTGACGATTTCCATCTGATCAGCTGGCGGAATTTCTTCACTCTGGCAGCTATTGCTGTCGGGGTGTTAATA
CCTGTTGGGCTGCGGTATTGGTTTCGGCAGAGGGTCCAGGACATTGAAGAGCAAGGCGGACTGATGGCAGAACCG
ATAGAAGACCCGTATGTTGATGACCCAGAGGACAGAATTTTGGCGGTGGGTCCGCCCGGACTCGGGTTGGCCAAG
AAGGCGGGAGAAAGGTTATTACTGAGAAGAGATGATGACGAGAGTAGTCTAGAGAGCTTCTATGACGAGGACGAG
GACATCATTTTGGAAGCTGGACCCCTGATACCCGACAAGGCGGGAGAGGAGCGGTTGCTTGTGGACGTGGGGAGT
TCGAGTAGTTCGAGCTTGGACTCGGTGATCAATCTGACACCTGGGGCGACGCATCCTCTCGCTCGCCGATGA
Gene >AgabiH97|081460
ATGCCGCCCCCTCTGCTCGTCCTTGACCCTCACCTAGGAACCTCGCATCGAAACGATTCCATGTACACCCTCAAC
ACCGTGGCCGACGACGACGACTCCAGCTCTCGCCGCTCCTCCAACACTTCTCCTCTCCTCTCCTCCGACTCCCAG
TCTTATGGTACCACTCCAAACTCTCAGTCCCGACCCTCCTCGGGAAAGGTCATTCTCCATGCGACGCTTAAAATG
GCCTGTATCTTTCTCGTCAGCACGCTCCTACTGGGCGGCGTCCTCTGGATCGCACTCCCCACCCTTGACGAGTGA
GTTCATGCAATGCTCCGTCTCTTATCCCGTTTTTCTCACGATATTGTCAGCGCGGACCGCCCACTGCTGCGGATA
CCCAAGTCCTTCTCGCAGCTTCAGGACCTGAACGGCTTGCTCAAGAAATACCGCGACATCTATCCTTACAGGATC
GTCGTTTGCTATGTTATCACCTACCTCTTGTTCGTCCTTTGTCCATCATCTCACGAGGCCCTACTCCTGATGACT
TTTGATGTTTACAGTCTACAGGCATTTTCGTTGCCCGGATCGATGTACCTGTCCATCCTTGGTGGTGCTGTATGG
GGCGTGACACGGGCTCTCCCTTTAACCTGTTGCTGCGTTGCAACGGGAGCAACGCTTTGCTATCTCATTTCAGCG
GCACTCGGACCTGCTCTTCTGACTATCCCAAAGTGGAAAGCTGTGCTGGACAAGTGGGCTGATAAAATTCAAGCG
AACAAGGAAAACATGATTTCGTTCCTCATCGTGCTTCGGATTGCACCTTTGCCTCCTCATTGGGTGGTCAATGTT
TTATGTCCCCATGTCGGCATCGGCATTGTCCCATTTTGGATTAGCACAGCACTCGGCATTCTCGGAGTGACGGTG
ATACACACAACGATTGGTGGTGGATTGGACGACATGACGAGCTCTGACGATTTCCATCTGATCAGCTGGCGGAAT
TTCTTCACTCTGGCAGCTATTGCTGTCGGGGTGTTAATACCTGTTGGGCTGCGGTATTGGTTTCGGCAGAGGGTC
CAGGACATTGAAGAGCAAGGCGGACTGATGGCAGAACCGATAGAAGACCCGTATGTTGATGACCCAGAGGACAGA
ATTTTGGCGGTGGGTCCGCCCGGACTCGGGTTGGCCAAGAAGGCGGGAGAAAGGTTATTACTGAGAAGAGATGAT
GACGAGAGTAGTCTAGAGAGCTTCTATGACGAGGACGAGGACATCATTTTGGAAGCTGGACCCCTGATACCCGAC
AAGGCGGGAGAGGAGCGGTTGCTTGTGGACGTGGGGAGTTCGAGTAGTTCGAGCTTGGACTCGGTGATCAATCTG
ACACCTGGGGCGACGCATCCTCTCGCTCGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail