Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081440
Gene name
Locationscaffold_5:853973..855134
Strand+
Gene length (bp)1161
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 3.7E-14 77 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 78 185 4.0E-09
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 67 160 9.0E-09
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 67 160 1.0E-08
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 67 160 3.0E-08
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 67 160 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 78 185 4.0E-09
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 67 160 9.0E-09
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 67 160 1.0E-08
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 67 160 3.0E-08
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 67 160 3.0E-08
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 67 160 3.0E-08
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 78 179 8.0E-08
sp|P59041|DJC30_MOUSE DnaJ homolog subfamily C member 30 OS=Mus musculus GN=Dnajc30 PE=1 SV=1 31 140 1.0E-07
sp|P9WNV8|DNAJ1_MYCTO Chaperone protein DnaJ 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ1 PE=3 SV=1 77 140 2.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 78 140 2.0E-07
sp|P0A549|DNAJ1_MYCBO Chaperone protein DnaJ 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ1 PE=3 SV=1 77 140 2.0E-07
sp|P9WNV9|DNAJ1_MYCTU Chaperone protein DnaJ 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ1 PE=1 SV=1 77 140 2.0E-07
sp|P81999|DJB11_CANLF DnaJ homolog subfamily B member 11 OS=Canis lupus familiaris GN=DNAJB11 PE=1 SV=2 77 160 2.0E-07
sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 78 271 2.0E-07
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 78 140 3.0E-07
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 78 140 4.0E-07
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 78 163 6.0E-07
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 72 140 7.0E-07
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 78 140 8.0E-07
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 72 173 9.0E-07
sp|Q6XL73|DNJ39_ARATH Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2 78 146 9.0E-07
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 78 223 1.0E-06
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 72 140 1.0E-06
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 68 179 1.0E-06
sp|C6BYN5|DNAJ_DESAD Chaperone protein DnaJ OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaJ PE=3 SV=1 72 140 2.0E-06
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 77 140 2.0E-06
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 77 140 2.0E-06
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 77 140 3.0E-06
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 77 140 3.0E-06
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 73 149 4.0E-06
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 78 140 5.0E-06
sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 78 140 5.0E-06
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 78 145 6.0E-06
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 78 140 6.0E-06
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 78 145 7.0E-06
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 78 145 7.0E-06
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 78 145 7.0E-06
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 78 145 7.0E-06
sp|P50026|DNAJ_SYNE7 Chaperone protein DnaJ OS=Synechococcus elongatus (strain PCC 7942) GN=dnaJ PE=3 SV=2 78 237 7.0E-06
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 79 146 9.0E-06
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 78 140 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081440
MLSYAFNTASTYFHLPVDEEEDKDIENYQRRYLTWVAEPSSPRNLPPPSPPLLCSGPSESEIERSQVVQTVLSTD
CLYQILGVPSAPLPDKITLRRAYLARSRACHPDKFPGNPDATRAFQKVAVAYDVLSKPSLKRTYDARSSDSTYNV
FASHTSTHADETFKGVVIGVFNDFLDGDLEVIKSLLKTIHEMHPSMRLGEDGINSVLLTLEAIREKALTCRTCIH
ALHCELSRLLEVQHAFRQLSYLDILGRSRLTIQLTRITLGLPIALERALLNDQSVVIETSRESDKRLFPRHVTRL
IKGVDTALERMEKILQ*
Coding >AgabiH97|081440
ATGCTGTCCTACGCATTCAACACAGCAAGCACCTACTTTCACCTCCCCGTAGACGAGGAAGAGGACAAGGACATT
GAAAACTACCAGCGCAGATATCTCACATGGGTGGCGGAGCCTTCCTCTCCCCGTAATCTCCCACCTCCGTCCCCT
CCTCTCCTTTGCTCTGGTCCTTCAGAGTCTGAAATCGAACGGTCGCAAGTTGTCCAAACTGTCTTATCTACCGAT
TGCCTTTACCAAATCCTCGGAGTGCCCTCCGCCCCCCTTCCCGATAAAATAACGCTACGGAGAGCCTATCTCGCC
CGCAGTAGAGCTTGTCATCCAGATAAATTTCCTGGCAACCCTGATGCAACACGTGCATTTCAGAAGGTTGCTGTT
GCTTATGATGTCCTTAGCAAACCTTCGTTAAAAAGAACGTATGACGCACGTTCGTCAGACTCGACGTATAACGTA
TTTGCATCGCACACATCTACTCATGCCGACGAGACGTTCAAAGGCGTCGTTATTGGTGTATTTAATGACTTTTTG
GATGGTGATTTAGAGGTCATCAAAAGCCTATTAAAAACGATCCATGAAATGCATCCTTCAATGAGACTTGGAGAA
GATGGTATCAATTCCGTACTACTTACTCTCGAAGCGATCCGAGAAAAGGCGTTGACATGCCGGACATGTATACAT
GCACTCCATTGTGAACTCTCAAGACTTCTTGAAGTACAGCATGCATTCAGACAACTCTCGTATCTCGATATACTC
GGACGCTCGAGGCTGACTATCCAGTTAACGCGGATCACACTAGGACTCCCCATTGCCCTGGAACGTGCACTACTC
AATGATCAAAGCGTCGTCATTGAAACCTCCAGGGAGAGCGATAAACGTTTATTCCCTCGACACGTAACACGGTTG
ATCAAAGGCGTAGACACGGCCCTAGAAAGAATGGAAAAAATACTCCAGTGA
Transcript >AgabiH97|081440
ATGCTGTCCTACGCATTCAACACAGCAAGCACCTACTTTCACCTCCCCGTAGACGAGGAAGAGGACAAGGACATT
GAAAACTACCAGCGCAGATATCTCACATGGGTGGCGGAGCCTTCCTCTCCCCGTAATCTCCCACCTCCGTCCCCT
CCTCTCCTTTGCTCTGGTCCTTCAGAGTCTGAAATCGAACGGTCGCAAGTTGTCCAAACTGTCTTATCTACCGAT
TGCCTTTACCAAATCCTCGGAGTGCCCTCCGCCCCCCTTCCCGATAAAATAACGCTACGGAGAGCCTATCTCGCC
CGCAGTAGAGCTTGTCATCCAGATAAATTTCCTGGCAACCCTGATGCAACACGTGCATTTCAGAAGGTTGCTGTT
GCTTATGATGTCCTTAGCAAACCTTCGTTAAAAAGAACGTATGACGCACGTTCGTCAGACTCGACGTATAACGTA
TTTGCATCGCACACATCTACTCATGCCGACGAGACGTTCAAAGGCGTCGTTATTGGTGTATTTAATGACTTTTTG
GATGGTGATTTAGAGGTCATCAAAAGCCTATTAAAAACGATCCATGAAATGCATCCTTCAATGAGACTTGGAGAA
GATGGTATCAATTCCGTACTACTTACTCTCGAAGCGATCCGAGAAAAGGCGTTGACATGCCGGACATGTATACAT
GCACTCCATTGTGAACTCTCAAGACTTCTTGAAGTACAGCATGCATTCAGACAACTCTCGTATCTCGATATACTC
GGACGCTCGAGGCTGACTATCCAGTTAACGCGGATCACACTAGGACTCCCCATTGCCCTGGAACGTGCACTACTC
AATGATCAAAGCGTCGTCATTGAAACCTCCAGGGAGAGCGATAAACGTTTATTCCCTCGACACGTAACACGGTTG
ATCAAAGGCGTAGACACGGCCCTAGAAAGAATGGAAAAAATACTCCAGTGA
Gene >AgabiH97|081440
ATGCTGTCCTACGCATTCAACACAGGTACGTCTCCCTCTTTCTCGCAGAGCACTTGCTCATATCTTCCCCAACAG
CAAGCACCTACTTTCACCTCCCCGTAGACGAGGAAGAGGACAAGGACATTGAAAACTACCAGCGCAGATATCTCA
CATGGGTGGCGGAGCCTTCCTCTCCCCGTAATCTCCCACCTCCGTCCCCTCCTCTCCTTTGCTCTGGTCCTTCAG
AGTCTGAAATCGAACGGTCGCAAGTTGTCCAAACTGTCTTATCTACCGATTGCCTTTACCAAATCCTCGGAGTGC
CCTCCGCCCCCCTTCCCGATAAAATAACGCTACGGAGAGCCTATCTCGCCCGCAGTAGAGCTTGTCATCCAGAGT
ATGTGTTCCTTCCTCATCCTCTACCCTCACTAGCTTATCCCCGTTGGTAGTAAATTTCCTGGCAACCCTGATGCA
ACACGTGCATTTCAGAAGGTTGCTGTTGCTTATGATGTCCTTAGCAAACCTTCGTTAAAAAGAACGTATGACGCA
CGTTCGTCAGACTCGACGTATAACGTATTTGCATCGCACACATCTACTCATGCCGACGAGACGTTCAAAGGCGTC
GTTATTGGTGTATTTAATGACTTTTTGGATGGTGATTTAGAGGTCATCAAAAGCCTATTAAGTGTGTATCAACAC
CAAATCAGTGACAGGGTTCTGTGCTGACTTATCTTATATAGAAACGATCCATGAAATGCATCCTTCAATGAGACT
TGGAGAAGATGGTATCAATTCCGTACTACTTACTCTCGAAGCGATCCGAGAAAAGGCGTTGAGTAAGTCCTGTTT
ATCTTATCGGATTTTCACCTTTTCAATATCTTTGTCTCAGCATGCCGGACATGTATACATGCACTCCATTGTGAA
CTCTCAAGACTTCTTGAAGTACAGCATGCATTCAGACAACTCTCGTATCTCGATATACTCGGACGCTCGAGGCTG
ACTATCCAGTTAACGCGGATCACACTAGGACTCCCCATTGCCCTGGAACGTGCACTACTCAATGATCAAAGCGTC
GTCATTGAAACCTCCAGGGAGAGCGATAAACGTTTATTCCCTCGACACGTAACACGGTTGATCAAAGGCGTAGAC
ACGGCCCTAGAAAGAATGGAAAAAATACTCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail