Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081420
Gene name
Locationscaffold_5:848424..852510
Strand-
Gene length (bp)4086
Transcript length (bp)3054
Coding sequence length (bp)3054
Protein length (aa) 1018

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 1.7E-34 17 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 10 1009 0.0E+00
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 22 1009 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 280 1010 3.0E-79
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 289 1009 1.0E-78
sp|Q5M9A7|PGAP2_XENLA Post-GPI attachment to proteins factor 2 OS=Xenopus laevis GN=pgap2 PE=2 SV=1 56 230 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 10 1009 0.0E+00
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 22 1009 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 280 1010 3.0E-79
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 289 1009 1.0E-78
sp|Q5M9A7|PGAP2_XENLA Post-GPI attachment to proteins factor 2 OS=Xenopus laevis GN=pgap2 PE=2 SV=1 56 230 5.0E-11
sp|Q9UHJ9|PGAP2_HUMAN Post-GPI attachment to proteins factor 2 OS=Homo sapiens GN=PGAP2 PE=1 SV=2 18 240 5.0E-10
sp|A6H7B8|PGAP2_BOVIN Post-GPI attachment to proteins factor 2 OS=Bos taurus GN=PGAP2 PE=2 SV=1 18 240 1.0E-09
sp|Q9VWK6|PGP2L_DROME Post-GPI attachment to proteins factor 2-like OS=Drosophila melanogaster GN=CG7990 PE=2 SV=4 59 214 1.0E-09
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 18 240 1.0E-09
sp|Q2ABP3|PGAP2_RAT Post-GPI attachment to proteins factor 2 OS=Rattus norvegicus GN=Pgap2 PE=2 SV=1 18 240 2.0E-09
sp|Q3TQR0|PGAP2_MOUSE Post-GPI attachment to proteins factor 2 OS=Mus musculus GN=Pgap2 PE=1 SV=2 18 240 5.0E-09
sp|A8KBG2|PGAP2_XENTR Post-GPI attachment to proteins factor 2 OS=Xenopus tropicalis GN=pgap2 PE=2 SV=1 56 230 1.0E-08
sp|A8XST1|PGAP2_CAEBR Post-GPI attachment to proteins factor 2 OS=Caenorhabditis briggsae GN=tag-189 PE=3 SV=2 25 230 1.0E-08
sp|Q22141|PGAP2_CAEEL Post-GPI attachment to proteins factor 2 OS=Caenorhabditis elegans GN=tag-189 PE=3 SV=2 25 230 2.0E-08
sp|Q29M88|PGAP2_DROPS Post-GPI attachment to proteins factor 2 OS=Drosophila pseudoobscura pseudoobscura GN=GA17744 PE=3 SV=2 57 222 1.0E-07
sp|Q9VPT7|PGAP2_DROME Post-GPI attachment to proteins factor 2 OS=Drosophila melanogaster GN=CG3876 PE=2 SV=2 56 222 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19
2 74 96 22
3 109 128 19
4 138 160 22
5 169 186 17
6 196 218 22
7 290 312 22
8 322 341 19
9 469 488 19
10 515 537 22
11 557 579 22
12 583 605 22
13 625 647 22
14 662 681 19
15 694 716 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081420
MPEASLRPLSASLSAASVARVHTILASTAFASALIIGSLLHYKKIVKNGVAGYPHEWFPSVSATIGDWYPERNIF
QIIIALTSGPRFALIYLQYYLQTQQTKNTIWPTFLFVIGLIRTLACGGWVYITSSDDHDAHDVFMILYIVCNIPW
MVGGVLSSGGRMVRKRRSLVAYAFFFTIIPLVYFFIQHKVYRIPGAYTRYAFFEWGLIFFDVFFDSIAEQEFVDA
DLSITVGTVQVQPSETESSKLASQSDAKANPSVNGEKVVSVTETSIWSSLSALAPRSFISFLSDVYLSCVFLTLF
TALIPTLFYFSIWELGLAGTELALFSVLSPFLLAHSSISAFAESQTGQVVLQGLSLSGLLAYLLKEPLARLLVVA
PAVQLATLDATAKWTEADGSYQAIIFGLGWVLTSLLKHANHSNNPLWPFIDAKAGGYNKTGLVLAILALAELATR
PRAPRDDVVTLHRAKKTHWLPVSLALGSLVFSIHSLLADSSALITWSWTGYENGAPRGPLPHVHSALTIVVQCIG
LAIGTYASSISVAQSSDSKEVAQQDKIAHSNSVWTIISHPGFYTFGATSTYVLYKYKNWPGYIGGLGVAFFLTCV
TPIVFHQICLVTNNGKTRNNLGRTFGTAFLVYCLMMLANIFTVAYAFVPGGVYFRERTDLVLLTQVALFFPMFVS
LNGRTVHSSKSKSSLETKASYIYLLLAVTSVLSGLVTVYRLPSSPPQSFRPGPRIIQAGIWTVHFGFDNEGHDSQ
RGIRNLLRDMQLDIVGLLETDLQSAAFGHRDLTRVIVEDLGYNVDLGPGPGQHTWGCVLLTKFPIIRSTHHLLPS
PHGELAPAIKAVLDIYGTEVTVVVSHNGQEEDPLDRELQSTELARIMATSYPKPVIFLGYVVTKPHASRPNPYEI
MVADGRVHDIDQEDTDRWCEYIFYRGLYRTSYARISRGIITDTEMQIGQFVLPRYGTGIVDDSYSARYSRAFKEQ
LPVEHWFPMEYYGGPGKGGVDGHYYHVFGTPLYYFLPANATV*
Coding >AgabiH97|081420
ATGCCAGAGGCATCCCTTCGGCCCCTCAGCGCCAGCCTCAGCGCGGCCTCGGTCGCCCGAGTTCACACTATTCTT
GCTTCTACCGCCTTTGCCTCGGCCCTCATAATTGGCTCCCTCTTGCACTATAAGAAAATTGTCAAAAATGGCGTC
GCCGGCTACCCACACGAGTGGTTTCCATCCGTATCTGCAACAATTGGTGATTGGTATCCAGAACGGAACATTTTT
CAAATCATCATTGCCCTAACTTCCGGCCCTCGCTTTGCTCTCATCTATCTCCAATATTATCTCCAGACCCAACAA
ACTAAAAACACTATCTGGCCAACTTTTCTCTTCGTTATTGGACTCATTCGTACCCTTGCCTGTGGTGGTTGGGTG
TATATTACCTCCAGCGACGACCATGATGCCCATGATGTATTCATGATCTTGTATATTGTCTGTAATATTCCCTGG
ATGGTGGGAGGTGTATTATCTTCAGGAGGGCGTATGGTTCGAAAAAGACGATCTTTGGTTGCCTACGCTTTCTTC
TTTACTATCATTCCACTTGTATATTTCTTCATCCAACACAAAGTTTATCGAATACCGGGAGCGTATACTCGTTAT
GCCTTCTTCGAATGGGGCTTGATATTCTTCGACGTGTTTTTCGACTCTATAGCAGAACAAGAGTTCGTTGACGCT
GATTTGAGTATCACTGTAGGAACAGTACAAGTGCAACCGTCAGAAACAGAATCATCGAAACTCGCATCACAGTCG
GATGCGAAAGCAAATCCATCTGTCAACGGTGAAAAAGTCGTCTCAGTCACTGAGACATCCATTTGGTCCTCTCTA
TCCGCTTTGGCACCTAGATCATTCATATCCTTCCTGTCTGATGTGTATTTATCCTGCGTCTTTCTGACCCTTTTT
ACGGCCCTCATCCCGACCCTTTTTTACTTTTCCATCTGGGAGCTGGGATTGGCTGGGACAGAATTAGCTCTTTTT
TCTGTTCTCTCTCCTTTTCTTCTTGCACATTCGTCAATATCCGCTTTCGCTGAAAGTCAGACAGGACAGGTCGTT
CTTCAGGGGTTGTCGTTGTCCGGTTTATTGGCATATCTTCTTAAAGAGCCTTTAGCGAGGCTGTTAGTTGTGGCA
CCGGCGGTGCAATTGGCGACACTCGATGCTACAGCTAAATGGACCGAAGCTGACGGGAGTTACCAGGCCATCATA
TTTGGTTTGGGTTGGGTCTTGACGTCTTTGTTAAAACATGCCAATCACAGTAATAACCCATTGTGGCCTTTCATC
GATGCCAAGGCAGGTGGATACAACAAAACAGGTCTGGTCCTCGCCATCCTTGCACTCGCGGAACTTGCTACACGA
CCCCGGGCTCCGAGGGACGACGTTGTGACACTTCACAGGGCAAAAAAGACACACTGGCTTCCTGTTTCTCTTGCA
CTCGGCAGTCTTGTTTTTAGTATTCATAGCCTACTCGCGGATTCTAGTGCCTTGATTACGTGGTCCTGGACGGGA
TATGAGAACGGCGCACCTCGAGGCCCTCTGCCTCATGTTCACAGTGCCTTGACAATCGTCGTACAATGCATCGGT
CTCGCGATTGGCACCTACGCATCGTCTATCTCTGTTGCTCAATCTTCGGATAGCAAGGAAGTAGCTCAGCAAGAT
AAGATAGCACATTCAAACAGTGTCTGGACAATCATCTCCCATCCCGGTTTCTATACTTTCGGTGCTACTTCGACC
TATGTTTTATACAAGTACAAAAACTGGCCTGGTTATATCGGCGGACTAGGCGTGGCTTTCTTCCTGACATGTGTT
ACTCCCATTGTCTTCCACCAAATCTGCTTGGTTACGAATAACGGTAAAACACGAAACAATCTAGGACGAACGTTT
GGGACTGCATTTCTTGTATACTGTTTAATGATGCTCGCCAATATTTTCACTGTTGCATATGCTTTTGTTCCCGGC
GGCGTTTATTTCCGGGAAAGAACTGACCTTGTTCTTTTAACTCAAGTTGCACTTTTCTTCCCCATGTTTGTATCA
CTCAATGGTCGTACGGTACATTCTTCGAAGTCCAAGTCGAGTCTGGAAACAAAAGCCTCCTACATATATCTGCTT
CTCGCAGTGACATCGGTTTTATCCGGTCTTGTCACTGTATATAGACTTCCATCTTCGCCGCCACAGTCATTCAGA
CCTGGACCAAGGATTATACAGGCAGGCATTTGGACGGTACACTTTGGCTTTGATAACGAGGGGCATGACAGTCAA
AGGGGAATTCGAAACCTATTGCGAGATATGCAACTAGATATTGTGGGTCTCCTCGAGACAGATTTACAAAGTGCT
GCCTTTGGTCACCGTGACCTAACTAGAGTGATAGTTGAAGATTTGGGATATAACGTCGACCTTGGACCAGGACCA
GGCCAGCACACATGGGGATGCGTCTTGTTGACTAAATTCCCCATTATCCGTTCAACTCATCACCTACTTCCCTCA
CCTCACGGCGAACTTGCACCAGCGATTAAAGCAGTCCTCGACATTTATGGTACCGAAGTGACCGTGGTGGTGTCG
CACAATGGACAAGAGGAGGATCCGCTGGATCGTGAACTTCAGAGCACAGAATTGGCACGTATCATGGCGACTTCA
TATCCCAAGCCTGTTATATTCCTTGGATATGTGGTAACAAAGCCTCATGCATCGCGACCAAATCCATACGAGATC
ATGGTCGCAGACGGCCGTGTACATGATATCGACCAAGAAGATACTGATCGTTGGTGCGAGTACATCTTTTATCGA
GGGCTGTACCGAACTTCGTATGCCCGAATATCACGAGGCATTATCACTGACACAGAAATGCAAATCGGCCAATTC
GTCTTACCTCGTTATGGGACAGGGATAGTGGATGATTCTTATTCAGCAAGATACTCTCGAGCATTCAAGGAGCAG
CTACCTGTCGAGCATTGGTTCCCAATGGAGTATTATGGCGGTCCAGGCAAGGGCGGTGTTGACGGGCACTATTAT
CATGTCTTTGGCACTCCACTCTATTATTTCCTACCGGCGAATGCGACTGTTTGA
Transcript >AgabiH97|081420
ATGCCAGAGGCATCCCTTCGGCCCCTCAGCGCCAGCCTCAGCGCGGCCTCGGTCGCCCGAGTTCACACTATTCTT
GCTTCTACCGCCTTTGCCTCGGCCCTCATAATTGGCTCCCTCTTGCACTATAAGAAAATTGTCAAAAATGGCGTC
GCCGGCTACCCACACGAGTGGTTTCCATCCGTATCTGCAACAATTGGTGATTGGTATCCAGAACGGAACATTTTT
CAAATCATCATTGCCCTAACTTCCGGCCCTCGCTTTGCTCTCATCTATCTCCAATATTATCTCCAGACCCAACAA
ACTAAAAACACTATCTGGCCAACTTTTCTCTTCGTTATTGGACTCATTCGTACCCTTGCCTGTGGTGGTTGGGTG
TATATTACCTCCAGCGACGACCATGATGCCCATGATGTATTCATGATCTTGTATATTGTCTGTAATATTCCCTGG
ATGGTGGGAGGTGTATTATCTTCAGGAGGGCGTATGGTTCGAAAAAGACGATCTTTGGTTGCCTACGCTTTCTTC
TTTACTATCATTCCACTTGTATATTTCTTCATCCAACACAAAGTTTATCGAATACCGGGAGCGTATACTCGTTAT
GCCTTCTTCGAATGGGGCTTGATATTCTTCGACGTGTTTTTCGACTCTATAGCAGAACAAGAGTTCGTTGACGCT
GATTTGAGTATCACTGTAGGAACAGTACAAGTGCAACCGTCAGAAACAGAATCATCGAAACTCGCATCACAGTCG
GATGCGAAAGCAAATCCATCTGTCAACGGTGAAAAAGTCGTCTCAGTCACTGAGACATCCATTTGGTCCTCTCTA
TCCGCTTTGGCACCTAGATCATTCATATCCTTCCTGTCTGATGTGTATTTATCCTGCGTCTTTCTGACCCTTTTT
ACGGCCCTCATCCCGACCCTTTTTTACTTTTCCATCTGGGAGCTGGGATTGGCTGGGACAGAATTAGCTCTTTTT
TCTGTTCTCTCTCCTTTTCTTCTTGCACATTCGTCAATATCCGCTTTCGCTGAAAGTCAGACAGGACAGGTCGTT
CTTCAGGGGTTGTCGTTGTCCGGTTTATTGGCATATCTTCTTAAAGAGCCTTTAGCGAGGCTGTTAGTTGTGGCA
CCGGCGGTGCAATTGGCGACACTCGATGCTACAGCTAAATGGACCGAAGCTGACGGGAGTTACCAGGCCATCATA
TTTGGTTTGGGTTGGGTCTTGACGTCTTTGTTAAAACATGCCAATCACAGTAATAACCCATTGTGGCCTTTCATC
GATGCCAAGGCAGGTGGATACAACAAAACAGGTCTGGTCCTCGCCATCCTTGCACTCGCGGAACTTGCTACACGA
CCCCGGGCTCCGAGGGACGACGTTGTGACACTTCACAGGGCAAAAAAGACACACTGGCTTCCTGTTTCTCTTGCA
CTCGGCAGTCTTGTTTTTAGTATTCATAGCCTACTCGCGGATTCTAGTGCCTTGATTACGTGGTCCTGGACGGGA
TATGAGAACGGCGCACCTCGAGGCCCTCTGCCTCATGTTCACAGTGCCTTGACAATCGTCGTACAATGCATCGGT
CTCGCGATTGGCACCTACGCATCGTCTATCTCTGTTGCTCAATCTTCGGATAGCAAGGAAGTAGCTCAGCAAGAT
AAGATAGCACATTCAAACAGTGTCTGGACAATCATCTCCCATCCCGGTTTCTATACTTTCGGTGCTACTTCGACC
TATGTTTTATACAAGTACAAAAACTGGCCTGGTTATATCGGCGGACTAGGCGTGGCTTTCTTCCTGACATGTGTT
ACTCCCATTGTCTTCCACCAAATCTGCTTGGTTACGAATAACGGTAAAACACGAAACAATCTAGGACGAACGTTT
GGGACTGCATTTCTTGTATACTGTTTAATGATGCTCGCCAATATTTTCACTGTTGCATATGCTTTTGTTCCCGGC
GGCGTTTATTTCCGGGAAAGAACTGACCTTGTTCTTTTAACTCAAGTTGCACTTTTCTTCCCCATGTTTGTATCA
CTCAATGGTCGTACGGTACATTCTTCGAAGTCCAAGTCGAGTCTGGAAACAAAAGCCTCCTACATATATCTGCTT
CTCGCAGTGACATCGGTTTTATCCGGTCTTGTCACTGTATATAGACTTCCATCTTCGCCGCCACAGTCATTCAGA
CCTGGACCAAGGATTATACAGGCAGGCATTTGGACGGTACACTTTGGCTTTGATAACGAGGGGCATGACAGTCAA
AGGGGAATTCGAAACCTATTGCGAGATATGCAACTAGATATTGTGGGTCTCCTCGAGACAGATTTACAAAGTGCT
GCCTTTGGTCACCGTGACCTAACTAGAGTGATAGTTGAAGATTTGGGATATAACGTCGACCTTGGACCAGGACCA
GGCCAGCACACATGGGGATGCGTCTTGTTGACTAAATTCCCCATTATCCGTTCAACTCATCACCTACTTCCCTCA
CCTCACGGCGAACTTGCACCAGCGATTAAAGCAGTCCTCGACATTTATGGTACCGAAGTGACCGTGGTGGTGTCG
CACAATGGACAAGAGGAGGATCCGCTGGATCGTGAACTTCAGAGCACAGAATTGGCACGTATCATGGCGACTTCA
TATCCCAAGCCTGTTATATTCCTTGGATATGTGGTAACAAAGCCTCATGCATCGCGACCAAATCCATACGAGATC
ATGGTCGCAGACGGCCGTGTACATGATATCGACCAAGAAGATACTGATCGTTGGTGCGAGTACATCTTTTATCGA
GGGCTGTACCGAACTTCGTATGCCCGAATATCACGAGGCATTATCACTGACACAGAAATGCAAATCGGCCAATTC
GTCTTACCTCGTTATGGGACAGGGATAGTGGATGATTCTTATTCAGCAAGATACTCTCGAGCATTCAAGGAGCAG
CTACCTGTCGAGCATTGGTTCCCAATGGAGTATTATGGCGGTCCAGGCAAGGGCGGTGTTGACGGGCACTATTAT
CATGTCTTTGGCACTCCACTCTATTATTTCCTACCGGCGAATGCGACTGTTTGA
Gene >AgabiH97|081420
ATGCCAGAGGCATCCCTTCGGCCCCTCAGCGCCAGCCTCAGCGCGGCCTCGGTCGCCCGAGTTCACACTATTCTT
GCTTCTACCGCCTTTGCCTCGGCCCTCATAATTGGCTCCCTCTTGCACTATAAGAAAATTGTCAAAAATGGCGTC
GCCGGCTACCCACACGAGTGGTTTCCATCCGTATCTGCAACGTGAGTGCTCGCTTCGTGATTCCCTGCAGATCCT
GATCGAGGATCCGCAGAATTGGTGATTGGTATCCAGAACGGAACATTTTTCAAATCATCATTGCCCTAACTTCCG
GCCCTCGCTTTGCTCTCATCTATCTCCAATATTATCTCCAGACCCAACAAACTAAAAACACTATCTGGCCAACTT
TTCTCTTCGTTATTGGACTCATTCGTACCCTTGCCTGTGGTGGTTGGGTGTATATTACCTCCAGCGACGACCATG
ATGCCCATGATGTATTCATGATCTTGTATATTGTCTGTAATATTCCCTGGATGGTGGGAGGTGTATTATCTTCAG
GAGGGCGTATGGTTCGAAAAAGACGGTATGAGAATCATTGAATCTTCTCATCTCAATTCGACTCAATCGGGCATG
ATAGATCTTTGGTTGCCTACGCGTCAGTCACGATCTTGACCCAAAGCCCTGCTTTCTCACCAGTTAACAGTTTCT
TCTTTACTATCATTCCACTTGTATATTTCTTCATCCAACACAAAGTTTATCGAATACCGGGAGGTCAGCCCCTGA
TCAAACTGGTATAGAGCCACTCACCAAATGCTCTGTGCAGCGTATACTCGTTATGCCTTCTTCGAATGGGGCTTG
ATATTCTTCGACGTGTTTTTCGACTCTATAGCAGAACAAGAGTTCGTTGACGCTGATTTGAGTGTGCGTTCAGCA
TGCAGCTTCCGAATCGTTCTCACCCAACGTTATTCTCAGATCACTGTAGGAACAGTACAAGTGCAACCGTCAGAA
ACGTATCTTCGTCTTCATCGTCTCGCCTAGCTTCCACTAACTGGAACAAAATCAGAGAATCATCGAAACTCGCAT
CACAGTCGGATGCGAAAGCAAATCCATCTGTCAACGGTGAAAAAGTCGTCTCAGTCACTGAGACATCCATTTGGT
CCTCTCTATCCGCTTTGGCACCTAGATCATTCATATCCTTCCTGTCTGATGTGTATTTATGTGCGTTAAATGCAA
TGACTCAACTCGACTTTCATCGATTGACAATAATCGACTTACTAGCCTGCGTCTTTCTGACCCTTTTTACGGCCC
TCATCCCGACCCTTTTTTACTTTTCCATCTGGGAGCTGGGATTGGCTGGGACAGAATTAGCTCTTTTTTCTGTTC
TCTCTCCTTTTCTTCTTGCACATTCGTCAATATCCGCTTTCGCTGAAAGTCAGACAGGACAGGTCGTTCTTCAGG
GGTTGTCGTTGTCCGGTTTATTGGCATATCTTCTTAAAGAGCCTTTAGCGAGGCTGTTAGTTGTGGCACCGGCGG
TGCAATTGGCGACACTCGATGCTACAGCTAAATGGACCGAAGCTGACGGGAGTTACCAGGCCATCAGTATGTTCT
CTGTGCCTCGAGAGTCGGCACTTTAACTCACATTTATAGTATTTGGTTTGGGTTGGGTCTTGACGTCTTTGTTAA
AACATGCCAATCACAGTAATAACCCATGTGCGCTCCTACAAACTAAAAATGAATCTTATTGGCTGACTTTTATGA
CTCCAGTGTGGCCTTTCATCGATGCCAAGGCAGGTGGATACAACAAAACAGGTCTGGTCCTCGCCATCCTTGCAC
TCGCGGAACTTGCTACACGACCCCGGGCTCCGAGGGACGACGTTGTGACACTTCACAGGGCAAAAAAGACACACT
GGCTTCCTGTTTCTCTTGCACTCGGCAGTCTTGTTTTTAGTATTCATAGCCTACTCGCGGATTCTAGTGCCTTGA
TTACGTGGTCCTGGACGGGATATGAGAACGGCGCACCTCGAGGCCCTCTGCCTCATGTTCACAGTGCCTTGACAA
TCGTCGTACAATGCATCGGTCTCGCGATTGGCACCTACGCATCGTCTATCTCTGTTGCTCAATCTTCGGATAGCA
AGGAAGTAGCTCAGCAAGATAAGATAGCACATTCAAACAGTGTCTGGACAATCATCTCCCATCCCGGTTTCTATA
CTTTCGGTGCTACTTCGACCTATGTTTTATACAAGTACAAAAACTGGCCTGGTTATATCGGCGGACTAGGCGTGG
CTTTCTTCCTGACATGTGTTACTCCCATTGTCTTCCACCAAATCTGCTTGGTTACGAATAACGGTAAAACACGAA
ACAATCTAGGACGAACGTTTGGGACTGCATTTCTTGTATACTGTTTAATGATGCTCGCCAATATTTTCACTGTTG
CATATGCTTTTGTTCCCGGCGGCGTTTATTTCCGGGAAAGAACTGACCTGTGAGTTTGATCATAGCATGATCGTA
AATCGTTGACATTCATTTGAATGGTAGTGTTCTTTTAACTCAAGTTGCACTTTTCTTCCCCATGTTTGTATCACT
CAATGGTCGTACGGTACATTCTTCGAAGTCCAAGTCGAGTCTGGAAACAAAAGCCTCCTACATATATCTGCTTCT
CGCAGTGACATCGGTTTTATCCGGTCTTGTCACTGTATATAGACTTCCATCTTCGCCGCCACAGTCATTCAGACC
TGGACCAAGGATTATACAGGCAGGCATTTGGACGGTACACTTTGGCTTTGATAACGAGGGGCATGACAGTCAAAG
GGGAATTCGAAACCTATTGCGAGATATGCAACTAGATATTGTGGGTCTCCTCGAGACAGATTTACAAGTATGTGC
TTCTAGCCTTGTTAAATGTTCTGTCGACTGAATTCATGGTCATAGAGTGCTGCCTTTGGTCACCGTGACCTGTAA
GTGGTCTGTTATTTATTTCACGGGTGCCCTGTAACTCACCTTCACTAGAACTAGAGTGATAGTTGAAGATTTGGG
ATATGTGTGTATCGCATCTCTCAGTGTTTCCTTCAAATTGACTTCATAATACTAGAACGTCGACCTTGGACCAGG
ACCAGGCCAGCACACATGGGGATGCGTCTTGTTGACTAAAGTAAGTACGTGATTGCATTCCAGCGTTCATCCAAA
CTAATTTCATGGTACACACAAGTTCCCCATTATCCGTTCAACTCATCACCTACTTCCCTCACCTCACGGCGAACT
TGCACCAGCGATTAAAGCAGTCCTCGACATTTATGGTACCGAAGTGACCGTGGTGGTGTCGCACAATGGACAAGG
TATCATCATAGATTGCTATCGTCCTCGTATCTCGCGTCTGATATGTATGCTTAAGAGGAGGATCCGCTGGATCGT
GAACTTCAGAGCACAGAATTGGCACGTATCATGGCGACTTCATATCCCAAGCCTGTTATATTCCTTGGATATGTG
GTAACAAAGCCTCATGCATCGCGACGTAAGTTGACGCGGCTCCACCAAGATGTACCATTGATTGTTCTATTATCC
TTTCAATCCAGCAAATCCATACGAGATCATGGTCGCAGACGGCCGTGTACATGATATCGACCAAGAAGATACTGA
TCGTTGGTATGTTCTTCAACACTAACCTAAGCGCTCAGCGCCCGCGGCTCTTCACTGACGTAACTTCCCTCGGTG
TTAGGTGCGAGTACATCTTTTATCGAGGGCTGTACCGAACTTCGTATGCCCGAATATCACGAGGCATTATCACTG
ACACAGAAATGCAAATCGGCCAATTCGTCTTACCTCGTTATGGGACAGGGATAGTGGATGATTCTTATTCAGCAA
GATACTCTCGAGCATTCAAGGAGCAGCTACCTGTCGAGCATGTGGGTTCAACTTCCTCTGACTTCAATTGATGTT
TTACTCATGTTTGTCAGTGGTTCCCAATGGAGTATTATGGCGGTCCAGGCAAGGGCGGTGTTGACGGGCACTATT
ATCATGTCTTTGGCACTGTAAGCAAAAATTCTTTTTTTTGTATTTCGCATCATTTGATCTGACGCCTGATAGCCA
CTCTATTATTTCCTACCGGCGAATGCGACTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail