Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081360
Gene name
Locationscaffold_5:832427..834349
Strand+
Gene length (bp)1922
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03348 Serinc Serine incorporator (Serinc) 2.4E-164 25 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 493 2.0E-108
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 493 9.0E-97
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 17 492 2.0E-72
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 28 492 2.0E-66
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 28 492 2.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12116|TMS1_YEAST Membrane protein TMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMS1 PE=1 SV=1 1 493 2.0E-108
sp|Q9HDY3|YK17_SCHPO Membrane protein PB1A10.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.07c PE=3 SV=1 1 493 9.0E-97
sp|A7S4N4|SERIC_NEMVE Probable serine incorporator OS=Nematostella vectensis GN=serinc PE=3 SV=1 17 492 2.0E-72
sp|Q13530|SERC3_HUMAN Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2 28 492 2.0E-66
sp|Q5R533|SERC3_PONAB Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1 28 492 2.0E-66
sp|A4FUZ5|SERC3_BOVIN Serine incorporator 3 OS=Bos taurus GN=SERINC3 PE=2 SV=1 28 492 3.0E-64
sp|A9UY97|SERIC_MONBE Probable serine incorporator OS=Monosiga brevicollis GN=serinc PE=3 SV=1 1 492 7.0E-63
sp|Q9QZI8|SERC1_MOUSE Serine incorporator 1 OS=Mus musculus GN=Serinc1 PE=1 SV=1 12 495 3.0E-60
sp|Q7TNK0|SERC1_RAT Serine incorporator 1 OS=Rattus norvegicus GN=Serinc1 PE=1 SV=1 12 495 1.0E-59
sp|Q5R419|SERC1_PONAB Serine incorporator 1 OS=Pongo abelii GN=SERINC1 PE=2 SV=1 12 495 1.0E-57
sp|Q9NRX5|SERC1_HUMAN Serine incorporator 1 OS=Homo sapiens GN=SERINC1 PE=1 SV=1 12 495 2.0E-57
sp|Q3MHV9|SERC1_BOVIN Serine incorporator 1 OS=Bos taurus GN=SERINC1 PE=2 SV=1 12 495 1.0E-56
sp|Q54UF8|SERIC_DICDI Probable serine incorporator OS=Dictyostelium discoideum GN=serinc PE=3 SV=1 43 438 9.0E-54
sp|Q9QZI9|SERC3_MOUSE Serine incorporator 3 OS=Mus musculus GN=Serinc3 PE=1 SV=2 28 492 4.0E-46
sp|Q8K0E7|SERC2_MOUSE Serine incorporator 2 OS=Mus musculus GN=Serinc2 PE=2 SV=1 94 492 4.0E-40
sp|Q8BHJ6|SERC5_MOUSE Serine incorporator 5 OS=Mus musculus GN=Serinc5 PE=2 SV=1 16 492 4.0E-39
sp|Q63175|SERC5_RAT Serine incorporator 5 OS=Rattus norvegicus GN=Serinc5 PE=2 SV=1 16 492 7.0E-39
sp|Q803X0|SERC5_DANRE Serine incorporator 5 OS=Danio rerio GN=serinc5 PE=2 SV=1 20 494 1.0E-38
sp|Q4R6L9|SERC5_MACFA Serine incorporator 5 OS=Macaca fascicularis GN=SERINC5 PE=2 SV=1 52 492 1.0E-38
sp|Q96SA4|SERC2_HUMAN Serine incorporator 2 OS=Homo sapiens GN=SERINC2 PE=2 SV=3 18 492 3.0E-37
sp|Q86VE9|SERC5_HUMAN Serine incorporator 5 OS=Homo sapiens GN=SERINC5 PE=2 SV=1 16 438 7.0E-36
sp|Q58CW5|SERC2_BOVIN Serine incorporator 2 OS=Bos taurus GN=SERINC2 PE=2 SV=1 17 492 6.0E-35
sp|Q5XK03|SERC4_MOUSE Serine incorporator 4 OS=Mus musculus GN=Serinc4 PE=2 SV=1 94 476 9.0E-28
sp|A6NH21|SERC4_HUMAN Serine incorporator 4 OS=Homo sapiens GN=SERINC4 PE=2 SV=1 94 476 3.0E-25
sp|A8WCG0|SERC4_RAT Serine incorporator 4 OS=Rattus norvegicus GN=Serinc4 PE=2 SV=2 94 476 2.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 50 72 22
3 96 118 22
4 138 160 22
5 164 186 22
6 207 229 22
7 239 261 22
8 268 287 19
9 307 329 22
10 419 441 22
11 466 488 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081360
MGLLMSLPLFGGLGTIASSCLAGAAFCCTSTAASMFFKSCNCNSSIATRIGFAIIFSLNSILAWLMKTDIMIKQI
QKWSFDYIKMECSGDKCYGVLAVHRICFALTLFHIILSASLIGVKDTRDKRGAIQNGWWGPKVLVWLILVIVSFV
IPNGFFIFWGDYVALIGATIFILFGLVLLVDFAHSWSETCLENWENSPSSNLWQWILISSTAFMYIFTITLTGLL
YAYFSGSGCTLNRFFITFNLIFCIAITVMCVHPLVQEYNPRSGLAQSAMVAAYCTYLIVSAITNHTHESKSCNPL
RDGSGAALGTRKAVVFLGGVFTFLAIAYSTTRAATQSAFVGGKKGRIQLDENSHSEMNFVTTQPGRTETPRYQAL
LAAVEAGAIPESALYEEQRHQDDDDDVGEDNDDEKTGTRYNYSWFHVIFAGGAMYVAMLLTDWNVVSKHPITGPA
DPNQDVYIGRSEVAMWMRVVSSWVCMILYTWSMWAPVILPDRFSD*
Coding >AgabiH97|081360
ATGGGTCTACTCATGTCGCTCCCTCTCTTCGGCGGACTAGGCACCATAGCCTCGTCATGTCTCGCCGGCGCCGCC
TTTTGCTGCACTTCAACCGCCGCTTCCATGTTCTTCAAGTCCTGTAACTGTAATTCGTCTATCGCTACTCGAATT
GGCTTTGCTATCATTTTCTCCCTCAACTCTATTCTGGCTTGGTTGATGAAGACCGATATTATGATAAAGCAGATT
CAGAAATGGAGTTTTGACTACATCAAGATGGAGTGTAGCGGGGATAAATGTTATGGTGTACTCGCGGTTCACCGT
ATCTGCTTTGCCCTTACCCTCTTTCATATCATCCTCAGCGCATCCCTCATAGGAGTCAAGGATACTCGAGATAAA
CGTGGTGCCATTCAGAACGGTTGGTGGGGCCCAAAGGTCCTGGTATGGCTAATACTCGTCATAGTCTCGTTCGTC
ATACCGAATGGCTTCTTCATCTTTTGGGGCGACTACGTTGCGTTGATAGGTGCCACCATCTTTATCTTATTCGGG
CTCGTCCTCCTTGTCGATTTCGCCCATTCCTGGTCTGAGACCTGTCTTGAGAATTGGGAGAACTCGCCTTCATCT
AACCTATGGCAATGGATCTTGATCAGTTCGACCGCCTTCATGTATATTTTCACGATCACTCTCACCGGTCTGCTC
TACGCCTACTTTTCAGGCTCAGGCTGTACTCTGAACCGATTCTTCATCACGTTCAATCTCATTTTCTGCATCGCT
ATCACTGTGATGTGCGTACACCCCCTTGTGCAGGAGTATAACCCTCGGTCAGGCCTTGCACAGTCCGCAATGGTC
GCTGCCTATTGTACATACCTAATTGTTTCTGCCATTACCAACCATACGCACGAGTCGAAGTCTTGCAACCCGTTA
CGGGATGGCTCTGGAGCTGCTTTGGGAACACGAAAGGCTGTTGTTTTTCTTGGTGGCGTCTTCACCTTCTTGGCT
ATCGCTTATTCAACCACGCGGGCTGCTACTCAGAGCGCTTTTGTGGGTGGGAAGAAAGGTCGTATTCAACTTGAC
GAGAACAGTCACTCCGAGATGAACTTTGTGACCACTCAACCTGGGCGGACAGAAACACCTCGCTACCAAGCATTG
TTGGCCGCTGTTGAAGCAGGAGCGATTCCCGAGTCGGCGCTTTACGAAGAGCAGCGCCATCAAGACGATGACGAT
GACGTAGGTGAAGACAACGACGATGAAAAGACTGGTACCCGTTACAATTACTCATGGTTCCATGTCATTTTCGCC
GGAGGTGCTATGTATGTAGCCATGCTCTTGACAGACTGGAACGTTGTTTCCAAGCATCCCATCACCGGGCCTGCA
GATCCTAACCAGGATGTCTACATCGGTCGGTCCGAGGTCGCCATGTGGATGCGCGTGGTTTCTAGTTGGGTGTGC
ATGATTTTGTATACTTGGAGTATGTGGGCACCTGTTATCCTGCCTGACAGATTCAGCGATTGA
Transcript >AgabiH97|081360
ATGGGTCTACTCATGTCGCTCCCTCTCTTCGGCGGACTAGGCACCATAGCCTCGTCATGTCTCGCCGGCGCCGCC
TTTTGCTGCACTTCAACCGCCGCTTCCATGTTCTTCAAGTCCTGTAACTGTAATTCGTCTATCGCTACTCGAATT
GGCTTTGCTATCATTTTCTCCCTCAACTCTATTCTGGCTTGGTTGATGAAGACCGATATTATGATAAAGCAGATT
CAGAAATGGAGTTTTGACTACATCAAGATGGAGTGTAGCGGGGATAAATGTTATGGTGTACTCGCGGTTCACCGT
ATCTGCTTTGCCCTTACCCTCTTTCATATCATCCTCAGCGCATCCCTCATAGGAGTCAAGGATACTCGAGATAAA
CGTGGTGCCATTCAGAACGGTTGGTGGGGCCCAAAGGTCCTGGTATGGCTAATACTCGTCATAGTCTCGTTCGTC
ATACCGAATGGCTTCTTCATCTTTTGGGGCGACTACGTTGCGTTGATAGGTGCCACCATCTTTATCTTATTCGGG
CTCGTCCTCCTTGTCGATTTCGCCCATTCCTGGTCTGAGACCTGTCTTGAGAATTGGGAGAACTCGCCTTCATCT
AACCTATGGCAATGGATCTTGATCAGTTCGACCGCCTTCATGTATATTTTCACGATCACTCTCACCGGTCTGCTC
TACGCCTACTTTTCAGGCTCAGGCTGTACTCTGAACCGATTCTTCATCACGTTCAATCTCATTTTCTGCATCGCT
ATCACTGTGATGTGCGTACACCCCCTTGTGCAGGAGTATAACCCTCGGTCAGGCCTTGCACAGTCCGCAATGGTC
GCTGCCTATTGTACATACCTAATTGTTTCTGCCATTACCAACCATACGCACGAGTCGAAGTCTTGCAACCCGTTA
CGGGATGGCTCTGGAGCTGCTTTGGGAACACGAAAGGCTGTTGTTTTTCTTGGTGGCGTCTTCACCTTCTTGGCT
ATCGCTTATTCAACCACGCGGGCTGCTACTCAGAGCGCTTTTGTGGGTGGGAAGAAAGGTCGTATTCAACTTGAC
GAGAACAGTCACTCCGAGATGAACTTTGTGACCACTCAACCTGGGCGGACAGAAACACCTCGCTACCAAGCATTG
TTGGCCGCTGTTGAAGCAGGAGCGATTCCCGAGTCGGCGCTTTACGAAGAGCAGCGCCATCAAGACGATGACGAT
GACGTAGGTGAAGACAACGACGATGAAAAGACTGGTACCCGTTACAATTACTCATGGTTCCATGTCATTTTCGCC
GGAGGTGCTATGTATGTAGCCATGCTCTTGACAGACTGGAACGTTGTTTCCAAGCATCCCATCACCGGGCCTGCA
GATCCTAACCAGGATGTCTACATCGGTCGGTCCGAGGTCGCCATGTGGATGCGCGTGGTTTCTAGTTGGGTGTGC
ATGATTTTGTATACTTGGAGTATGTGGGCACCTGTTATCCTGCCTGACAGATTCAGCGATTGA
Gene >AgabiH97|081360
ATGGGTCTACTCATGTCGCTCCCTCTCTTCGGCGGACTAGGCACCATAGCCTCGTCATGTCTCGCCGGCGCCGCC
TTTTGCTGCACTTCAACCGCCGGTGAGTCGACTACTTTACACATTCTCATATCTGCTTACAACCATCGTAGCTTC
CATGTTCTTCAAGTCCTGTAACTGTAATTCGTCTATCGCTACTCGAATTGGCTTTGCTGTCAGTATTGCTGCCGT
CACGTTCTGTATCGCCCCTGCTGAGCCCAGCGTACCAGATCATTTTCTCCCTCAACTCTATTCTGGCTTGGTTGA
TGAAGACCGATATTATGATAAAGCAGATTCAGAAATGGAGTTTTGACTACATCAAGATGGAGTGTAGCGGGGATA
AATGTTATGGTGTACTCGCGGTCCGTAATGTCTGACCTTTCACCCTTTCTCCGCTGACTTGGTATTATTTGGTAT
CCTCAGGTTCACCGTATCTGCTTTGCCCTTACCCTCTTTCATATCATCCTCAGCGCATCCCTCATAGGAGTCAAG
GATACTCGAGATAAACGTGGTGCCATTCAGAACGGGTAAGCGTTCGGTTAATCATGAATTAGACCAGCTAGTAAC
GGACGGACAGTTGGTGGGGCCCAAAGGTCCTGGTATGGCTAATACTCGTCATAGTCTCGTTCGTCATACCGAATG
GCTTCTTCATCTTTTGGGGCGACTACGTTGCGTTGATAGGTGCCACCATCTTTATCTTATTCGGGCTCGTCCTCC
TTGTCGATTTCGCCCATTCCTGGTCTGAGACCTGTCTTGAGAATTGGGAGAACTCGCCTTCATCTAACCTATGGC
AATGGATCTTGATCAGTTCGACCGCCTTCATGTATATTTTCACGATCACTCTCACCGGTCTGCTCTACGCCTACT
TTTCAGGCTCAGGCTGTACTCTGAACCGATTCTTCATCACGTTCAATCTCATTTTCTGCATCGCTATCACTGTGA
TGTGCGTACACCCCCTTGTGCAGGAGTATAACCCTCGGTCAGGCCTTGCACAGTCCGCAATGGTCGCTGCCTATT
GTACATACCTAATTGTTTCTGCCATTACCAACCATACGCACGAGTCGAAGTCTTGCAACCCGTTACGGGATGGCT
CTGGAGCTGCTTTGGGAACACGAAAGGCTGTTGTTTTTCTTGGTGGCGTCTTCACCTTCTTGGCTATCGCTTATT
CAACCACGCGGGCTGCTACTCAGAGCGCTTTTGTGGGTGGGAAGAAAGGTCGTATTCAACTTGACGAGAACAGTC
ACTCCGAGATGAACTTTGTGACCACTCAACCTGGGCGGACAGAAACACCTCGCTACCAAGCATTGTTGGCCGCTG
TTGAAGCAGGGTGAGTCTTTTTTGCCCGCCGCTAATGGGAAATCATGGGTCTCATTGTATTTTAGAGCGATTCCC
GAGTCGGCGCTTTACGAAGAGCAGCGCCATCAAGACGATGACGATGACGTAGGTGAAGACAACGACGATGAAAAG
ACTGGTACCCGTTACAATGTACGCCTCCCCTCTACGACCGATGATCTTGATTCTAAAAGAATCACAGTACTCATG
GTTCCATGTCATTTTCGCCGGAGGTGCTATGTATGTAGCCATGCTCTTGACAGACTGGTAGGTAGTTTATTATCC
TCGTTGGTCGCCGTTCTGATTTTCCTATTCGCCGTATCTTCTAGGAACGTTGTTTCCAAGCATCCCATCACCGGG
CCTGCAGATCCTAACCAGGATGTCTACATCGGTCGGTCCGAGGTCGCCATGTGGATGCGCGTGGTTTCTAGTTGG
GTGTGCATGATTTTGTATACTTGGAGTATGTGGGCACCTGTTATCCTGCCTGACAGGTGTGTGTTGTTGTTAGGT
TCCTCTGCGTCAGATGCTTACCAGATTCATATAGATTCAGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail