Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081160
Gene name
Locationscaffold_5:791230..792287
Strand-
Gene length (bp)1057
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.9E-22 4 179
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.9E-19 4 170
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 4.4E-10 4 125
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.6E-09 1 175
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 3.5E-05 3 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 3 281 1.0E-10
sp|O66256|TLL_AGGAC dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD(+)) OS=Aggregatibacter actinomycetemcomitans GN=tll PE=1 SV=1 1 180 2.0E-10
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 1 183 5.0E-10
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 2 195 7.0E-10
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 1 158 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 3 281 1.0E-10
sp|O66256|TLL_AGGAC dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD(+)) OS=Aggregatibacter actinomycetemcomitans GN=tll PE=1 SV=1 1 180 2.0E-10
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 1 183 5.0E-10
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 2 195 7.0E-10
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 1 158 2.0E-09
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 2 177 4.0E-09
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 3 177 6.0E-09
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 3 177 1.0E-08
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 2 177 1.0E-08
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 3 177 5.0E-08
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 3 225 1.0E-07
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 2 168 5.0E-07
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 3 158 1.0E-06
sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 4 155 2.0E-06
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 3 177 3.0E-06
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 3 177 3.0E-06
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 1 168 4.0E-06
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 1 168 4.0E-06
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 1 177 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0016229 steroid dehydrogenase activity No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081160
MNLLITGCNGSVGKRIVRLALNRGYIVTGVDFTTLSEELKELIEHKKDNFTYHQIDLGDYDCALEILRTSECQAV
IHLAAVRDPKDYKVHTHNSNVVLSWNILRACAELGITRIAQASSVNVVKMVYSVQADFKYFPIDEDHPREPDEPY
GLSKLICELQADTITRRYPTLRIASLRLSWSLPRKDYAWGRQAQDAAKDLWGYVYEDSVADAFLLSITCDTTKWP
SKHEAFLVAAPEINRDLDSGELKKSFYPDVPVKEGFEIKGRQGFFDCRKAERLLGWVHRDNMPE*
Coding >AgabiH97|081160
ATGAACCTACTCATAACAGGCTGCAACGGCAGCGTAGGCAAGCGTATAGTCCGTCTCGCCCTCAACCGAGGTTAC
ATCGTGACTGGAGTCGATTTCACCACTCTATCAGAAGAACTCAAAGAGCTCATCGAACACAAAAAAGATAATTTC
ACATATCATCAAATCGATCTTGGAGACTATGATTGTGCTCTGGAAATCCTTCGAACTTCGGAATGTCAAGCCGTT
ATCCATTTGGCGGCAGTGCGAGACCCGAAAGATTATAAAGTGCACACTCACAATAGTAATGTCGTTTTATCGTGG
AATATTTTAAGGGCTTGTGCAGAACTGGGTATAACACGAATCGCACAAGCCTCCTCTGTCAATGTCGTAAAGATG
GTCTACAGCGTCCAAGCCGACTTTAAATATTTCCCAATCGACGAAGACCACCCACGCGAACCCGATGAACCCTAT
GGATTATCCAAACTAATATGTGAACTGCAAGCTGACACCATAACTCGTCGTTATCCTACTCTCCGCATCGCAAGC
CTTCGCTTGTCTTGGTCTCTTCCTCGTAAGGACTATGCTTGGGGGCGACAAGCTCAGGACGCAGCGAAAGACCTC
TGGGGATATGTTTATGAAGATTCTGTCGCTGACGCATTTTTGTTGTCCATCACATGTGATACAACCAAATGGCCC
TCCAAACATGAAGCATTCCTTGTGGCTGCACCCGAAATTAACAGAGACCTCGATAGTGGCGAGTTGAAGAAGTCA
TTCTACCCTGATGTGCCAGTAAAAGAGGGGTTTGAGATTAAGGGCCGTCAAGGGTTCTTTGATTGTAGAAAGGCG
GAGAGGTTGTTAGGATGGGTTCATAGGGACAATATGCCCGAATGA
Transcript >AgabiH97|081160
ATGAACCTACTCATAACAGGCTGCAACGGCAGCGTAGGCAAGCGTATAGTCCGTCTCGCCCTCAACCGAGGTTAC
ATCGTGACTGGAGTCGATTTCACCACTCTATCAGAAGAACTCAAAGAGCTCATCGAACACAAAAAAGATAATTTC
ACATATCATCAAATCGATCTTGGAGACTATGATTGTGCTCTGGAAATCCTTCGAACTTCGGAATGTCAAGCCGTT
ATCCATTTGGCGGCAGTGCGAGACCCGAAAGATTATAAAGTGCACACTCACAATAGTAATGTCGTTTTATCGTGG
AATATTTTAAGGGCTTGTGCAGAACTGGGTATAACACGAATCGCACAAGCCTCCTCTGTCAATGTCGTAAAGATG
GTCTACAGCGTCCAAGCCGACTTTAAATATTTCCCAATCGACGAAGACCACCCACGCGAACCCGATGAACCCTAT
GGATTATCCAAACTAATATGTGAACTGCAAGCTGACACCATAACTCGTCGTTATCCTACTCTCCGCATCGCAAGC
CTTCGCTTGTCTTGGTCTCTTCCTCGTAAGGACTATGCTTGGGGGCGACAAGCTCAGGACGCAGCGAAAGACCTC
TGGGGATATGTTTATGAAGATTCTGTCGCTGACGCATTTTTGTTGTCCATCACATGTGATACAACCAAATGGCCC
TCCAAACATGAAGCATTCCTTGTGGCTGCACCCGAAATTAACAGAGACCTCGATAGTGGCGAGTTGAAGAAGTCA
TTCTACCCTGATGTGCCAGTAAAAGAGGGGTTTGAGATTAAGGGCCGTCAAGGGTTCTTTGATTGTAGAAAGGCG
GAGAGGTTGTTAGGATGGGTTCATAGGGACAATATGCCCGAATGA
Gene >AgabiH97|081160
ATGAACCTACTCATAACAGGCTGCAACGGCAGCGTAGGCAAGCGTATAGTCCGTCTCGCCCTCAACCGAGGTTAC
ATCGTGACTGGAGTCGATTTCACCACTCTATCAGAAGAACTCAAAGAGCTCATCGAACACAAAAAAGATAATTTC
ACATATCATCAAATCGATCTTGGAGACTATGATTGTGCTCTGGAAATCCTTCGAACTTCGGAATGTCAAGCCGTT
ATCCATTTGGCGGCAGTGCGAGACCCGAAAGATTATAAAGTGCACACTCACAATAGGTTCGATTCACAAAAAGTT
CTTTTGTCAATGAACTCAGGATGTTACATAGTAATGTCGTTTTATCGTGGAATATTTTAAGGGCTTGTGCAGAAG
TGCGGTTACAATTTCTCTCCAGATTAACTTACTATTGACGGGTTTCACCTTGAAATGATGAATATAATAGCTGGG
TATAACACGAATCGCACAAGCCTCCTCTGTCAATGTCGTAAAGATGGTCTACAGCGTCCAAGCCGACTTTAAATA
TTTCCCAATCGACGAAGACCACCCACGCGAACCCGATGAACCCTATGGATTATCCAAACTGTAAGTCACACCGCA
CACACGTACTCTCCCCCGTACTGCACTCTTGACATGTCAAAACATCCTTAGAATATGTGAACTGCAAGCTGACAC
CATAACTCGTCGTTATCCTACTCTCCGCATCGCAAGCCTTCGCTTGTCTTGGTCTCTTCCTCGTAAGGACTATGC
TTGGGGGCGACAAGCTCAGGACGCAGCGAAAGACCTCTGGGGATATGTTTATGAAGATTCTGTCGCTGACGCATT
TTTGTTGTCCATCACATGTGATACAACCAAATGGCCCTCCAAACATGAAGCATTCCTTGTGGCTGCACCCGAAAT
TAACAGAGACCTCGATAGTGGCGAGTTGAAGAAGTCATTCTACCCTGATGTGCCAGTAAAAGAGGGGTTTGAGAT
TAAGGGCCGTCAAGGGTTCTTTGATTGTAGAAAGGCGGAGAGGTTGTTAGGATGGGTTCATAGGGACAATATGCC
CGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail