Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081080
Gene name
Locationscaffold_5:773362..774197
Strand-
Gene length (bp)835
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081080
MHNTFFSVALFFGLAINAVFAEFAVSTPDIFACEGSEARFSWEPATPPYNMLLVAAEDPCGDPIMDLGETKNTLF
SMKTDKLKEGQKVQLSIEDANGEEGWSGDITVKKCVAASSVASSSVASSSAGASSSGYGGPVAATTLVVTPTVDV
SGTPAEPSPSVAPVGAANAGDDPFGLGNAASIPRHISVPAVVLSAIAGVIALL*
Coding >AgabiH97|081080
ATGCATAACACATTCTTTTCTGTCGCTCTCTTCTTCGGCCTCGCCATCAACGCTGTCTTTGCTGAGTTTGCCGTC
TCCACCCCAGACATTTTTGCTTGCGAAGGCTCAGAGGCTCGCTTCTCATGGGAACCTGCCACACCCCCTTACAAC
ATGCTCCTAGTTGCTGCTGAAGACCCGTGCGGTGATCCGATTATGGACCTCGGTGAAACCAAGAATACCCTCTTC
TCTATGAAGACCGACAAGCTCAAGGAAGGCCAGAAAGTCCAATTGTCCATTGAGGACGCTAACGGTGAAGAGGGT
TGGAGTGGTGATATCACTGTCAAGAAGTGTGTAGCTGCTTCAAGCGTTGCGAGTTCAAGTGTCGCGAGTTCAAGC
GCCGGTGCATCGTCCTCTGGTTACGGAGGCCCAGTAGCTGCAACAACCCTCGTCGTCACTCCCACCGTGGATGTT
AGTGGAACCCCCGCCGAACCTAGCCCGAGTGTCGCACCGGTTGGTGCAGCCAATGCTGGTGATGATCCATTCGGC
CTCGGCAATGCTGCCTCTATCCCCCGTCACATCAGCGTTCCCGCTGTTGTTCTGAGTGCCATTGCAGGTGTTATC
GCCCTCCTATAA
Transcript >AgabiH97|081080
ATGCATAACACATTCTTTTCTGTCGCTCTCTTCTTCGGCCTCGCCATCAACGCTGTCTTTGCTGAGTTTGCCGTC
TCCACCCCAGACATTTTTGCTTGCGAAGGCTCAGAGGCTCGCTTCTCATGGGAACCTGCCACACCCCCTTACAAC
ATGCTCCTAGTTGCTGCTGAAGACCCGTGCGGTGATCCGATTATGGACCTCGGTGAAACCAAGAATACCCTCTTC
TCTATGAAGACCGACAAGCTCAAGGAAGGCCAGAAAGTCCAATTGTCCATTGAGGACGCTAACGGTGAAGAGGGT
TGGAGTGGTGATATCACTGTCAAGAAGTGTGTAGCTGCTTCAAGCGTTGCGAGTTCAAGTGTCGCGAGTTCAAGC
GCCGGTGCATCGTCCTCTGGTTACGGAGGCCCAGTAGCTGCAACAACCCTCGTCGTCACTCCCACCGTGGATGTT
AGTGGAACCCCCGCCGAACCTAGCCCGAGTGTCGCACCGGTTGGTGCAGCCAATGCTGGTGATGATCCATTCGGC
CTCGGCAATGCTGCCTCTATCCCCCGTCACATCAGCGTTCCCGCTGTTGTTCTGAGTGCCATTGCAGGTGTTATC
GCCCTCCTATAA
Gene >AgabiH97|081080
ATGCATAACACATTCTTTTCTGTCGCTCTCTTCTTCGGCCTCGCCATCAACGCTGTCTTTGCTGAGTTTGCCGTC
TCCACCCCAGACATTTTTGCTGTATGCGATTCCACCCCCCTGCTATTTAACTTCATTGAATCTGCGTCTCTTAGT
GCGAAGGCTCAGAGGCTCGCTTCTCATGGGAACCTGCCACACCCCCTTACAACATGCTCCTAGTTGCTGCTGAAG
ACCCGTGCGGTGATCCGATGTGGGCTTTGTCCATTAATGGTCCCTTGCCATCAGCCTGACTCTTATTTTCTTAGT
ATGGACCTCGGTGAAACCAAGAATACCCTCTTCTCTATGAAGACCGACAAGCTCAAGGAAGGCCAGAAAGTCCAA
TTGTCCATTGAGGACGCTAACGGTGAAGAGGGTTGGAGTGGTGATGTGCGTACCCTTTATGCTTGGCATCATTCA
GCTTGGGTGTGGGACACTAATTGTTGGTTACCCAGATCACTGTCAAGAAGTGTGTAGCTGCTTCAAGCGTTGCGA
GTTCAAGTGTCGCGAGTTCAAGCGCCGGTGCATCGTCCTCTGGTTACGGAGGCCCAGTAGCTGCAACAACGTAAG
TCTATCTTTCACCATATATAAACTTAAATTAACGGTCAACTTCAGCCTCGTCGTCACTCCCACCGTGGATGTTAG
TGGAACCCCCGCCGAACCTAGCCCGAGTGTCGCACCGGTTGGTGCAGCCAATGCTGGTGATGATCCATTCGGCCT
CGGCAATGCTGCCTCTATCCCCCGTCACATCAGCGTTCCCGCTGTTGTTCTGAGTGCCATTGCAGGTGTTATCGC
CCTCCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail