Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081050
Gene name
Locationscaffold_5:767927..769923
Strand+
Gene length (bp)1996
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.3E-15 70 168
PF08241 Methyltransf_11 Methyltransferase domain 2.6E-10 71 171
PF13489 Methyltransf_23 Methyltransferase domain 4.9E-09 66 174
PF08242 Methyltransf_12 Methyltransferase domain 1.4E-07 71 170
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.1E-06 69 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 55 174 2.0E-08
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 54 186 3.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 60 174 4.0E-07
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 54 186 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 55 174 2.0E-08
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 54 186 3.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 60 174 4.0E-07
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 54 186 7.0E-07
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 69 174 7.0E-07
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 54 186 7.0E-07
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 42 186 1.0E-06
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 70 174 2.0E-06
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 70 174 2.0E-06
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 54 185 2.0E-06
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 71 186 2.0E-06
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 70 174 3.0E-06
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 70 174 3.0E-06
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 70 174 3.0E-06
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 70 174 3.0E-06
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 55 184 4.0E-06
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 54 186 6.0E-06
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 70 168 8.0E-06
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 55 186 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081050
MDAEQPSVVRNVEHVLVGQRKAKRGHGKVPYPVAEYSQDLANLDIWDNMFFESIWGSPTVYNFPIAPGLVLDIGC
GTGWWVMNMAQRWPNTLFVGFDILEIQPRLRDFEHFLELTERISWVHGNFLDDFPFPDDHFDYVRICRAALAIPE
DEWQWFLEQVRRVMRPGGLFEIIEEDPIFPSPTLPIPIPKISSISSPTTPREGSQETLASSSSGSGETVSEERLK
TKNRSRLSSFRSTRSLGKPLENKKSRARASSSATVSSNTIGLSNHPQNHTKLKIAWENMLTNRFISNKILSILPF
YLSTIFSGVEVFDLYSVPLPSNTPLDQDAAEDDSLYSIPRPCNNNINDINAKNGVTTKCNSNDNNNAVVNYPIQT
ELPRLQAMDLQELAGMHLHYTVGFIKACKDAIRQEYRMLFPFVEGIVVEQSEKAQIPVIGVDFPCGEESKPEQFE
VEWNDWICDMEDRMRLRKRMNSQVAWNEPCSPRGGKPVWRHWRKAIDQVLAREDKSVFDFPTDPDNLCRSVKAYM
GWKAPDNICRFGE*
Coding >AgabiH97|081050
ATGGACGCCGAACAACCCAGCGTCGTCCGCAATGTCGAGCATGTTCTCGTAGGCCAGAGAAAGGCTAAGCGCGGC
CATGGCAAGGTCCCCTACCCCGTCGCAGAATATTCCCAAGACCTCGCAAATTTGGACATCTGGGATAACATGTTC
TTTGAGAGCATCTGGGGCTCTCCGACTGTATACAATTTTCCTATAGCGCCCGGACTTGTCCTCGACATTGGCTGT
GGCACCGGTTGGTGGGTCATGAACATGGCCCAGCGCTGGCCAAACACACTCTTCGTCGGCTTCGACATTCTCGAA
ATTCAGCCTCGCTTACGGGATTTCGAACATTTTCTCGAACTGACAGAGCGTATAAGTTGGGTTCACGGCAATTTT
CTGGACGATTTTCCCTTCCCAGATGACCATTTTGACTATGTACGAATCTGTCGCGCCGCCTTGGCAATTCCAGAA
GACGAGTGGCAGTGGTTCCTGGAGCAAGTTCGTCGTGTTATGAGACCAGGAGGACTTTTCGAGATCATCGAGGAA
GATCCAATCTTCCCTAGTCCAACTCTCCCAATCCCTATCCCGAAAATCTCCTCTATATCATCGCCTACCACTCCT
AGAGAAGGATCTCAAGAAACCCTTGCTTCTTCAAGTTCAGGTTCAGGTGAAACCGTTTCCGAGGAGCGATTAAAA
ACAAAAAACAGGTCTCGCCTTTCTTCGTTTAGGAGTACACGTTCTCTGGGCAAGCCCCTAGAAAATAAAAAATCT
CGCGCTAGGGCCTCTTCCTCGGCGACTGTGTCTTCTAACACTATTGGTTTATCAAATCATCCGCAAAATCATACG
AAACTCAAAATTGCTTGGGAAAACATGCTTACGAATCGATTCATCTCGAACAAGATCCTTTCTATCCTTCCTTTT
TACCTATCCACTATCTTTTCAGGTGTTGAAGTTTTTGATTTATATTCTGTGCCTTTGCCCAGTAATACACCGTTG
GATCAAGACGCTGCAGAAGATGATTCGTTGTATTCAATTCCTCGTCCCTGCAACAACAACATCAACGACATCAAT
GCGAAAAATGGGGTGACGACGAAATGCAATTCCAATGATAATAATAATGCTGTTGTGAATTATCCTATTCAGACT
GAACTTCCACGGCTTCAGGCGATGGATTTACAAGAATTGGCTGGGATGCATTTACATTATACGGTTGGGTTTATC
AAGGCTTGTAAAGATGCGATTCGACAAGAGTATCGGATGTTGTTTCCTTTTGTGGAGGGTATTGTTGTTGAACAG
AGTGAAAAGGCGCAGATACCTGTTATTGGGGTGGATTTTCCTTGTGGTGAAGAGAGTAAACCAGAACAATTTGAA
GTGGAATGGAATGATTGGATATGTGACATGGAAGACCGTATGCGTTTGAGGAAACGAATGAATAGTCAAGTGGCG
TGGAATGAACCGTGTAGTCCAAGGGGTGGGAAACCTGTTTGGAGACATTGGAGGAAGGCGATTGATCAGGTTTTG
GCGAGGGAGGATAAGAGTGTGTTTGATTTTCCGACGGATCCGGATAATTTGTGTAGATCGGTGAAGGCTTATATG
GGTTGGAAGGCGCCGGATAATATTTGTCGGTTTGGGGAATGA
Transcript >AgabiH97|081050
ATGGACGCCGAACAACCCAGCGTCGTCCGCAATGTCGAGCATGTTCTCGTAGGCCAGAGAAAGGCTAAGCGCGGC
CATGGCAAGGTCCCCTACCCCGTCGCAGAATATTCCCAAGACCTCGCAAATTTGGACATCTGGGATAACATGTTC
TTTGAGAGCATCTGGGGCTCTCCGACTGTATACAATTTTCCTATAGCGCCCGGACTTGTCCTCGACATTGGCTGT
GGCACCGGTTGGTGGGTCATGAACATGGCCCAGCGCTGGCCAAACACACTCTTCGTCGGCTTCGACATTCTCGAA
ATTCAGCCTCGCTTACGGGATTTCGAACATTTTCTCGAACTGACAGAGCGTATAAGTTGGGTTCACGGCAATTTT
CTGGACGATTTTCCCTTCCCAGATGACCATTTTGACTATGTACGAATCTGTCGCGCCGCCTTGGCAATTCCAGAA
GACGAGTGGCAGTGGTTCCTGGAGCAAGTTCGTCGTGTTATGAGACCAGGAGGACTTTTCGAGATCATCGAGGAA
GATCCAATCTTCCCTAGTCCAACTCTCCCAATCCCTATCCCGAAAATCTCCTCTATATCATCGCCTACCACTCCT
AGAGAAGGATCTCAAGAAACCCTTGCTTCTTCAAGTTCAGGTTCAGGTGAAACCGTTTCCGAGGAGCGATTAAAA
ACAAAAAACAGGTCTCGCCTTTCTTCGTTTAGGAGTACACGTTCTCTGGGCAAGCCCCTAGAAAATAAAAAATCT
CGCGCTAGGGCCTCTTCCTCGGCGACTGTGTCTTCTAACACTATTGGTTTATCAAATCATCCGCAAAATCATACG
AAACTCAAAATTGCTTGGGAAAACATGCTTACGAATCGATTCATCTCGAACAAGATCCTTTCTATCCTTCCTTTT
TACCTATCCACTATCTTTTCAGGTGTTGAAGTTTTTGATTTATATTCTGTGCCTTTGCCCAGTAATACACCGTTG
GATCAAGACGCTGCAGAAGATGATTCGTTGTATTCAATTCCTCGTCCCTGCAACAACAACATCAACGACATCAAT
GCGAAAAATGGGGTGACGACGAAATGCAATTCCAATGATAATAATAATGCTGTTGTGAATTATCCTATTCAGACT
GAACTTCCACGGCTTCAGGCGATGGATTTACAAGAATTGGCTGGGATGCATTTACATTATACGGTTGGGTTTATC
AAGGCTTGTAAAGATGCGATTCGACAAGAGTATCGGATGTTGTTTCCTTTTGTGGAGGGTATTGTTGTTGAACAG
AGTGAAAAGGCGCAGATACCTGTTATTGGGGTGGATTTTCCTTGTGGTGAAGAGAGTAAACCAGAACAATTTGAA
GTGGAATGGAATGATTGGATATGTGACATGGAAGACCGTATGCGTTTGAGGAAACGAATGAATAGTCAAGTGGCG
TGGAATGAACCGTGTAGTCCAAGGGGTGGGAAACCTGTTTGGAGACATTGGAGGAAGGCGATTGATCAGGTTTTG
GCGAGGGAGGATAAGAGTGTGTTTGATTTTCCGACGGATCCGGATAATTTGTGTAGATCGGTGAAGGCTTATATG
GGTTGGAAGGCGCCGGATAATATTTGTCGGTTTGGGGAATGA
Gene >AgabiH97|081050
ATGGACGCCGAACAACCCAGCGTCGTCCGCAATGTCGAGCATGTTCTCGTAGGCCAGAGAAAGGCTAAGCGCGGC
CATGGCAAGGTCCCCTACCCCGTCGCAGAATATTCCCAAGACCTCGCAAATTTGTAACCCACTTTCTTGCTAGGG
GTGCCATGTTCTCATCACTGCTTTAGGGACATCTGGGATAACATGTTCTTTGAGAGCATCTGGGGCTCTCCGACT
GTATACAATTTTCCTATAGCGCCCGGACTTGTCCTCGACATTGGCTGTGGCACCGGTTGGTGGGTCATGAACATG
GCCCAGCGCTGGCCAGTACGTCTCTTCTCTTGTTCAATATCTGTGCTAACCTATATTATTCAAGAACACACTCTT
CGTCGGCTTCGACATTCTCGAAATTCAGCCTCGCTTACGGGATTTCGAACATTTTCTCGAACTGACAGAGCGTAT
AAGTTGGGTTCACGGCAATTTGTATGTCCCTTCCCCACCCTTTAATTGTGCCTCGCTAAGATGATCAAGTCTGGA
CGATTTTCCCTTCCCAGATGACCATTTTGACTATGTACGAATCTGTCGCGCCGCCTTGGCAATTCCAGAAGACGA
GGTGAGCCACTCATGTCTTGCCTGCTCGAGCTTATGTAGAACTCTCTCATCAGTGGCAGTGGTTCCTGGAGGCAA
GTTTTGGCACTTTTTTATTGCCGGTGCCTTGTTCTCATCAATGTAATAGCAAGTTCGTCGTGTTATGAGACCAGG
AGGACTTTTCGAGGTTAGCGTGCCTTCCGCATAATACCGCCGCGTGTTACTGATCGTTTTCAGATCATCGAGGAA
GATCCAATCTTCCCTAGTCCAACTCTCCCAATCCCTATCCCGAAAATCTCCTCTATATCATCGCCTACCACTCCT
AGAGAAGGATCTCAAGAAACCCTTGCTTCTTCAAGTTCAGGTTCAGGTGAAACCGTTTCCGAGGAGCGATTAAAA
ACAAAAAACAGGTCTCGCCTTTCTTCGTTTAGGAGTACACGTTCTCTGGGCAAGCCCCTAGAAAATAAAAAATCT
CGCGCTAGGGCCTCTTCCTCGGCGACTGTGTCTTCTAACACTATTGGTTTATCAAATCATCCGCAAAATCATACG
AAACTCAAAATTGCTTGGGAAAACATGCTTACGAATCGATTCATCTCGAACAAGATCCTTTCTATCCTTCCTTTT
TACCTATCCACTATCTTTTCAGGTGTTGAAGTTTTTGATTTATATTCTGTGCCTTTGCCCAGTAATACACCGTTG
GATCAAGACGCTGCAGAAGATGATTCGTTGTATTCAATTCCTCGTCCCTGCAACAACAACATCAACGACATCAAT
GCGAAAAATGGGGTGACGACGAAATGCAATTCCAATGATAATAATAATGCTGTTGTGAATTATCCTATTCAGACT
GAACTTCCACGGCTTCAGGCGATGGATTTACAAGAATTGGCTGGGATGCATTTACATTATACGGTTGGGTTTATC
AAGGCTTGTAAAGATGCGATTCGACAAGAGTATCGGATGTTGTTTCCTTTTGTGGAGGGTATTGTTGTTGAACAG
AGTGAAAAGGCGCAGATACCTGTTATTGGGGTGGATTTTCCTTGTGGTGAAGAGAGTAAACCAGAACAATTTGAA
GTGGAATGGAATGATTGGATATGGTGGGTTTCTCGATTTTTATTAAAGTCACCCTCTCACGTTTATGCAATAAAT
GATTAACTTATACCTTTTATTATTTAGTGACATGGAAGACCGTATGCGTTTGAGGAAACGAATGAATAGTCAAGT
GGCGTGGAATGAACCGTGTAGTCCAAGGGGTGGGAAACCTGTTTGGAGACATTGGAGGAAGGCGATTGATCAGGT
TTTGGCGAGGGAGGATAAGAGTGTGTTTGATTTTCCGACGGATCCGGATAATTTGTGTAGATCGGTGAAGGCTTA
TATGGGTTGGAAGGCGCCGGATAATATTTGTCGGTTTGGGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail