Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081040
Gene name
Locationscaffold_5:767202..767777
Strand-
Gene length (bp)575
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05821 NDUF_B8 NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8) 3.9E-08 19 143

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081040
MHSALIRPVVAATRRAALASRSYASQRPPTYEERPSYDTTDPEPNYPQLPYVSRQHLPPKQWDDMLLRRNYGDTL
HEQEEVLSMWGPDIPPAGLTGESALRQLLGALAGFAVLGVYIKYFGIPDRPAVPREFPYDGLVKELGGVEAIKAN
PERVE*
Coding >AgabiH97|081040
ATGCACAGCGCCCTTATCCGCCCTGTGGTGGCGGCCACCCGACGCGCCGCACTCGCCAGCAGGTCATACGCTAGC
CAGCGACCACCCACCTATGAAGAACGACCGTCATACGATACAACAGATCCGGAGCCCAACTATCCTCAGCTGCCC
TATGTGTCCCGACAGCATCTGCCTCCGAAACAATGGGACGATATGCTCCTGAGGAGAAACTATGGCGACACTTTG
CACGAGCAGGAGGAGGTGTTGTCGATGTGGGGACCGGATATTCCACCTGCGGGACTGACGGGTGAATCCGCGTTG
CGACAGCTTCTAGGGGCGTTGGCTGGGTTTGCCGTGTTGGGAGTGTATATCAAATATTTTGGGATCCCGGATCGA
CCAGCAGTGCCCCGGGAGTTCCCCTATGATGGACTGGTAAAGGAGCTTGGCGGGGTTGAGGCGATCAAGGCAAAT
CCGGAGCGAGTAGAATAG
Transcript >AgabiH97|081040
ATGCACAGCGCCCTTATCCGCCCTGTGGTGGCGGCCACCCGACGCGCCGCACTCGCCAGCAGGTCATACGCTAGC
CAGCGACCACCCACCTATGAAGAACGACCGTCATACGATACAACAGATCCGGAGCCCAACTATCCTCAGCTGCCC
TATGTGTCCCGACAGCATCTGCCTCCGAAACAATGGGACGATATGCTCCTGAGGAGAAACTATGGCGACACTTTG
CACGAGCAGGAGGAGGTGTTGTCGATGTGGGGACCGGATATTCCACCTGCGGGACTGACGGGTGAATCCGCGTTG
CGACAGCTTCTAGGGGCGTTGGCTGGGTTTGCCGTGTTGGGAGTGTATATCAAATATTTTGGGATCCCGGATCGA
CCAGCAGTGCCCCGGGAGTTCCCCTATGATGGACTGGTAAAGGAGCTTGGCGGGGTTGAGGCGATCAAGGCAAAT
CCGGAGCGAGTAGAATAG
Gene >AgabiH97|081040
ATGCACAGCGCCCTTATCCGCCCTGTGGTGGCGGCCACCCGACGCGCCGCACTCGCCAGCAGGTCATACGCTAGC
CAGCGACCACCCACCTATGAAGAACGACCGTCATACGATACAACAGATCCGGAGCCCAACTATCCTCAGCTGCCC
TATGTGTCCCGACAGCATCTGCCTCCGAAACAATGGGACGATATGCTCCTGAGGAGAAACTATGGCGACACTGTA
CGGCAGGGCTCTTTGCGTGCGATGTTGACGTGATTGACCCTTTTTGTCACAGTTGCACGAGCAGGAGGAGGTGTT
GTCGATGTGGGGACCGGATATTCCACCTGCGGGACTGACGGGTGAATCCGCGTTGCGACAGCTTCTAGGGGCGTT
GGCTGGGTTTGCCGTGTTGGGAGTGTATATCAAATATTTTGGGATCCCGGATCGACCAGCAGTGCCCCGGGAGTT
CCCCTATGATGGACTGGTAAAGGAGCTTGGCGGGGTTGAGGCGATCAAGGTAGGCAAGCAGCTGGATAATGGCCC
CTGGCACAGACTGACGACCTCTGCAGGCAAATCCGGAGCGAGTAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail