Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|081010
Gene name
Locationscaffold_5:757424..758196
Strand-
Gene length (bp)772
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 3.6E-22 12 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 4 157 9.0E-54
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 3 153 8.0E-51
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 4 153 2.0E-50
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 3 153 6.0E-50
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 4 159 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 4 157 9.0E-54
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 3 153 8.0E-51
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 4 153 2.0E-50
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 3 153 6.0E-50
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 4 159 1.0E-47
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 4 153 2.0E-47
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 1 154 1.0E-46
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 4 154 2.0E-45
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 4 154 2.0E-45
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 4 154 5.0E-45
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 4 154 7.0E-45
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 8 154 3.0E-42
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 1 157 5.0E-42
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 11 154 3.0E-35
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 12 154 5.0E-35
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 14 159 8.0E-19
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 11 154 6.0E-18
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 11 154 6.0E-18
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 11 154 1.0E-17
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 11 154 1.0E-17
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 11 156 5.0E-17
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 8 156 2.0E-16
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 11 154 3.0E-15
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 11 154 3.0E-15
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 11 154 3.0E-15
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 14 156 3.0E-14
sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 5 154 9.0E-12
sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana GN=At1g67280 PE=1 SV=1 11 154 2.0E-10
sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 5 154 8.0E-09
sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 12 157 4.0E-08
sp|P39586|YWBC_BACSU Uncharacterized protein YwbC OS=Bacillus subtilis (strain 168) GN=ywbC PE=3 SV=1 11 152 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|081010
MPRDPETASYRFNHTMLRIKDPKVSLQFYQEILGMELQDKHDGGDFTLYFLAYNHEGAELSLDEKKRSRFAREGI
LELTHNHGTESDANFQGYASGNTDPGRGFGHIAITVDDVEKACERFEKLNVPFKKRLTDGKMKNIAFILDPDGYW
VEVVGNTVKL*
Coding >AgabiH97|081010
ATGCCCCGCGACCCAGAAACAGCCAGCTACAGGTTCAACCATACGATGCTCCGCATCAAGGACCCCAAGGTGTCT
TTGCAGTTCTATCAAGAGATCCTTGGGATGGAATTGCAAGATAAGCATGACGGCGGCGATTTCACTCTCTATTTC
TTGGCATATAATCATGAAGGGGCCGAGTTGAGTCTCGACGAGAAAAAGAGATCAAGGTTCGCACGTGAAGGCATC
TTGGAATTGACGCACAATCATGGCACTGAATCCGACGCCAACTTCCAAGGTTATGCTAGTGGAAACACGGATCCT
GGTCGTGGATTTGGACATATCGCTATAACCGTCGATGATGTTGAAAAAGCTTGCGAGCGTTTTGAAAAACTCAAT
GTCCCTTTCAAGAAGAGGCTCACTGACGGAAAAATGAAGAACATCGCTTTTATTTTGGATCCTGATGGTTACTGG
GTAGAGGTCGTTGGAAACACTGTGAAGCTATAA
Transcript >AgabiH97|081010
ATGCCCCGCGACCCAGAAACAGCCAGCTACAGGTTCAACCATACGATGCTCCGCATCAAGGACCCCAAGGTGTCT
TTGCAGTTCTATCAAGAGATCCTTGGGATGGAATTGCAAGATAAGCATGACGGCGGCGATTTCACTCTCTATTTC
TTGGCATATAATCATGAAGGGGCCGAGTTGAGTCTCGACGAGAAAAAGAGATCAAGGTTCGCACGTGAAGGCATC
TTGGAATTGACGCACAATCATGGCACTGAATCCGACGCCAACTTCCAAGGTTATGCTAGTGGAAACACGGATCCT
GGTCGTGGATTTGGACATATCGCTATAACCGTCGATGATGTTGAAAAAGCTTGCGAGCGTTTTGAAAAACTCAAT
GTCCCTTTCAAGAAGAGGCTCACTGACGGAAAAATGAAGAACATCGCTTTTATTTTGGATCCTGATGGTTACTGG
GTAGAGGTCGTTGGAAACACTGTGAAGCTATAA
Gene >AgabiH97|081010
ATGCCCCGCGACCCAGAAACAGCCAGCTACAGGGTAAGGAGTTCTTTTTGCCCACTCGCCTGCTACATGTTAATC
CTACCAGTTCAACCATACGATGCTCCGCATCAAGGACCCCAAGGTGTCTTTGCAGTTCTATCAAGAGGTAGGACT
TCTTCAATTCTCCGCTTGTCAGATCATGACCCTAATAACGACAATGGTTATCAGATCCTTGGGATGGAATTGCAA
GATAGTACGATCAATTATCTTATCAGCTATGCGTGATCAACTCTAATCGACTCGTATACAGAGCATGACGGCGGC
GATTTCACTCTCTATTTCTTGGCATATAATCATGAAGGGGCCGAGTTGAGTCTCGACGAGAAAAAGAGATCAAGG
TTCGCACGTGAAGGTACGATATCAATTTACAAATTCCTTGGCTAGCAAGTATTCACTGCATGAGAATTTGTCCAG
GCATCTTGGAATTGACGCACAATCATGGCACTGAATCCGACGCCAACTTCCAAGGTTATGCTAGTGGAAACACGG
ATCCTGGTCGTGGATTTGGACATATCGCTATAACCGTCGATGATGTTGAAAAAGCTTGCGAGCGTTTTGAAAAAC
TCAATGTCCCTTTCAAGAAGAGGCTCACTGACGGAAAAATGAAGAACATCGCTTTTATTTTGGATCCTGATGGGT
GAGTATTTATGGAACATAGCACATCGTATTTTTTCATGACCCTAATATGTTTGCTAGTTACTGGGTAGAGGTCGT
TGGAAACACTGTGAAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail