Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080970
Gene name
Locationscaffold_5:748792..749988
Strand-
Gene length (bp)1196
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 4.3E-15 47 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 19 211 1.0E-39
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 226 7.0E-20
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 226 7.0E-20
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 226 8.0E-20
sp|Q6Y2X3|DJC14_HUMAN DnaJ homolog subfamily C member 14 OS=Homo sapiens GN=DNAJC14 PE=2 SV=2 20 123 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 19 211 1.0E-39
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 226 7.0E-20
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 226 7.0E-20
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 226 8.0E-20
sp|Q6Y2X3|DJC14_HUMAN DnaJ homolog subfamily C member 14 OS=Homo sapiens GN=DNAJC14 PE=2 SV=2 20 123 4.0E-10
sp|Q95J56|DJC14_BOVIN DnaJ homolog subfamily C member 14 OS=Bos taurus GN=DNAJC14 PE=1 SV=1 20 123 6.0E-10
sp|Q921R4|DJC14_MOUSE DnaJ homolog subfamily C member 14 OS=Mus musculus GN=Dnajc14 PE=2 SV=2 32 123 6.0E-10
sp|Q5XIX0|DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus GN=Dnajc14 PE=1 SV=1 32 123 2.0E-09
sp|P48353|HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HLJ1 PE=1 SV=1 32 110 6.0E-08
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 32 108 8.0E-08
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 49 108 1.0E-07
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 2 113 9.0E-07
sp|Q6YPM2|DNAJ_ONYPE Chaperone protein DnaJ OS=Onion yellows phytoplasma (strain OY-M) GN=dnaJ PE=3 SV=1 49 108 2.0E-06
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 2 113 2.0E-06
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 49 108 3.0E-06
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 49 108 3.0E-06
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 49 108 3.0E-06
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 9 108 5.0E-06
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 45 108 6.0E-06
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 47 114 6.0E-06
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 45 108 6.0E-06
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 36 113 6.0E-06
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 47 108 6.0E-06
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 49 114 7.0E-06
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 45 108 7.0E-06
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 49 114 7.0E-06
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 49 110 8.0E-06
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 43 108 8.0E-06
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 43 108 8.0E-06
sp|Q93R26|DNAJ_TETHA Chaperone protein DnaJ OS=Tetragenococcus halophilus GN=dnaJ PE=3 SV=1 43 108 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080970
MSSSTNQTSSDSKKQSTDDIEKLLNREASAFQREVEVERILKAFKLNAYDILDLDVAATPEDIKKKYRQLSLFIH
PDKAQHARAPEAFDILKKAESELSDKNKREELDAIMNQARIEILKSYNLPTTLAHNDPSLRDIVKPSFRVRVRAR
AKDILIEEEVRRRKAIRLNLANEGLEARKKDEEVASRKRKVEEDKQWEENREQRVDSWRSFASNKDGRKKKKSKV
IPIKFTHPSPTGTRTYSVVDSFCFLSNHGCINHSAGTKTCSGR*
Coding >AgabiH97|080970
ATGTCCTCCTCCACTAACCAGACATCGTCAGACTCTAAGAAACAGTCCACAGATGATATAGAGAAGCTACTCAAT
CGAGAGGCGTCAGCTTTCCAACGTGAAGTCGAAGTGGAACGAATCCTCAAGGCCTTCAAGCTCAACGCTTATGAT
ATTCTAGACCTTGACGTTGCAGCTACCCCCGAGGATATTAAGAAGAAGTACAGGCAACTGTCGTTATTTATCCAC
CCGGACAAAGCACAACATGCTCGCGCCCCAGAAGCTTTCGATATTCTAAAGAAGGCCGAATCAGAGCTCTCTGAC
AAAAATAAGCGTGAGGAGCTCGATGCAATAATGAATCAAGCTCGTATCGAAATACTCAAATCTTACAACCTACCC
ACCACTTTGGCCCATAACGACCCAAGTTTGAGGGATATAGTGAAACCGAGTTTCAGGGTTCGCGTACGGGCTAGA
GCGAAGGACATACTTATTGAAGAAGAGGTGAGAAGACGAAAGGCTATCAGGCTGAATCTAGCCAATGAAGGCCTG
GAAGCAAGGAAAAAAGATGAAGAAGTCGCGTCCAGGAAACGTAAAGTGGAAGAAGACAAACAATGGGAGGAGAAC
CGAGAACAGCGTGTAGACAGCTGGCGTTCCTTTGCCAGCAACAAAGACGGCCGCAAGAAGAAAAAGTCCAAAGTA
ATACCCATCAAGTTCACGCATCCCTCGCCCACAGGAACACGGACGTATAGTGTTGTAGATTCTTTTTGTTTCCTG
TCCAATCATGGTTGTATCAATCATTCTGCTGGTACAAAGACTTGTAGCGGGCGATAA
Transcript >AgabiH97|080970
ATGTCCTCCTCCACTAACCAGACATCGTCAGACTCTAAGAAACAGTCCACAGATGATATAGAGAAGCTACTCAAT
CGAGAGGCGTCAGCTTTCCAACGTGAAGTCGAAGTGGAACGAATCCTCAAGGCCTTCAAGCTCAACGCTTATGAT
ATTCTAGACCTTGACGTTGCAGCTACCCCCGAGGATATTAAGAAGAAGTACAGGCAACTGTCGTTATTTATCCAC
CCGGACAAAGCACAACATGCTCGCGCCCCAGAAGCTTTCGATATTCTAAAGAAGGCCGAATCAGAGCTCTCTGAC
AAAAATAAGCGTGAGGAGCTCGATGCAATAATGAATCAAGCTCGTATCGAAATACTCAAATCTTACAACCTACCC
ACCACTTTGGCCCATAACGACCCAAGTTTGAGGGATATAGTGAAACCGAGTTTCAGGGTTCGCGTACGGGCTAGA
GCGAAGGACATACTTATTGAAGAAGAGGTGAGAAGACGAAAGGCTATCAGGCTGAATCTAGCCAATGAAGGCCTG
GAAGCAAGGAAAAAAGATGAAGAAGTCGCGTCCAGGAAACGTAAAGTGGAAGAAGACAAACAATGGGAGGAGAAC
CGAGAACAGCGTGTAGACAGCTGGCGTTCCTTTGCCAGCAACAAAGACGGCCGCAAGAAGAAAAAGTCCAAAGTA
ATACCCATCAAGTTCACGCATCCCTCGCCCACAGGAACACGGACGTATAGTGTTGTAGATTCTTTTTGTTTCCTG
TCCAATCATGGTTGTATCAATCATTCTGCTGGTACAAAGACTTGTAGCGGGCGATAA
Gene >AgabiH97|080970
ATGTCCTCCTCCACTAACCAGACATCGTCAGACTCTAAGAAACAGTCCACAGATGATATAGAGAAGCTACTCAAT
CGAGAGGCGTCAGCTTTCCAACGTGAAGTCGAAGTGGAACGAATCCTCAAGGCCTTCAAGCTCAAGTACGTCTCT
CGTAAATAGTCTAATTGGAAATTCCTTGAGTTTGAACTTTCTATCTAGCGCTTATGATATTCTAGACCTTGACGT
TGCAGCTACCCCCGAGGATATTAAGAAGAAGTACAGGCAACTGTCGTTATGTACGTGCGGTATTTCACTTATTCT
GCGCTGGCCGCTGATTGATTCTTTCAGTTATCCACCCGGACAAAGCACAACATGCTCGCGCCCCAGAAGCTTTCG
ATATTCTAAAGAAGGTACATATCGTTTGAATGCTTGCTTTCACACTTCGGTTGTTGAACATATCCACAAACAGGC
CGAATCAGAGCTCTCTGACAAAAATAAGCGTGAGGAGCTCGATGCAATAATGAATCAAGCTCGTATCGAAATACT
CAAATCTTACAACCTACCCACCACTTTGGCCCATAACGACCCAAGTTTGAGGGATATAGTGAAACCGAGTTTCAG
GGTTCGCGTACGGGCTAGAGCGAAGGACATACTTATTGAAGAAGAGGTGAGAAGACGAAAGTAAGTCTGTGATTT
GTTACAGCGAGGTGGGTGACTTGACCGGAGTGTTTTTTTACCTAGGGCTATCAGGCTGAATCTAGCCAATGAAGG
CCTGGAAGCAAGGAAAAAAGATGAAGAAGTCGCGTCCAGGAAACGTAAAGTGGAAGAAGACAAACAATGGGAGGG
TAGGCTCTCTCACTTTATTCTCTCTCAGTCCCAACCGTTGATAACGACTCTACAGAGAACCGAGAACAGCGTGTA
GACAGCTGGCGTTCCTTTGCCAGCAACAAAGACGGCCGCAAGAAGAAAAAGTCCAAAGTAGCCATTCTTGGTTGA
ACGGGTAACAACGAAGCATAAACTCTCTTTACCAGGTAATACCCATCAAGTTCACGCATCCCTCGCCCACAGGAA
CACGGACGTATAGTGTTGTAGATTCTTTTTGTTTCCTGTCCAATCATGGTTGTATGTATGTATCATTAATTTGTT
TTGTTTCCTCTCTTTCCCTGATGCGACGAAGCAATCATTCTGCTGGTACAAAGACTTGTAGCGGGCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail