Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080900
Gene name
Locationscaffold_5:732529..733452
Strand-
Gene length (bp)923
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 4.3E-17 59 194
PF13649 Methyltransf_25 Methyltransferase domain 3.6E-06 62 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9D853|MET10_MOUSE Protein-lysine N-methyltransferase Mettl10 OS=Mus musculus GN=Mettl10 PE=1 SV=1 4 231 1.0E-48
sp|Q9P7Z3|EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=see1 PE=2 SV=1 5 230 2.0E-47
sp|Q5D013|MET10_DANRE Protein-lysine N-methyltransferase mettl10 OS=Danio rerio GN=mettl10 PE=2 SV=1 4 231 1.0E-46
sp|P40516|EFM4_YEAST Protein-lysine N-methyltransferase EFM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM4 PE=1 SV=1 2 232 1.0E-42
sp|Q5JPI9|MET10_HUMAN Protein-lysine N-methyltransferase METTL10 OS=Homo sapiens GN=METTL10 PE=1 SV=2 7 196 5.0E-40

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080900
MTTELQPSKLGTKEHWDKVYSEELTNFEEIGDEGEIWFGEESIEKMVDWCLMHVPSLSNPAVLEVGSGNGALLFA
LAEAGYSQKLLIGIDYSDDAVKLSTKISATRNATEIMFSVCDFLREDPSLPSSPEHSNAPSCWDLVLDKGTYDAI
ALGSKDPSGRSPAGAYPHRLCRLLKPGGLFLITSCNFTEEELKSSFITEETGLQYHSRIQHPTFSFGGRSGSIVS
SVAFKKPL*
Coding >AgabiH97|080900
ATGACTACGGAGCTACAGCCTTCAAAGCTTGGCACAAAGGAGCACTGGGACAAAGTCTACTCTGAAGAACTTACT
AATTTCGAAGAGATCGGTGATGAGGGCGAAATTTGGTTTGGTGAAGAGTCAATTGAGAAGATGGTCGACTGGTGC
CTCATGCATGTGCCTTCCTTATCGAACCCAGCCGTTCTGGAAGTGGGTAGTGGAAACGGAGCCCTGCTATTTGCG
CTTGCAGAAGCTGGTTATTCTCAGAAGCTTCTGATTGGAATCGACTACAGTGACGATGCCGTCAAGTTATCCACA
AAAATTTCAGCAACCCGTAACGCGACAGAAATCATGTTCAGCGTATGCGATTTCCTGCGAGAAGACCCGAGCCTT
CCATCGAGCCCAGAACACAGCAATGCACCAAGCTGTTGGGACCTCGTCCTGGATAAAGGCACATATGATGCTATC
GCTTTGGGCTCAAAAGACCCAAGTGGAAGGTCTCCCGCAGGAGCTTATCCACACCGGCTTTGCCGGCTGCTCAAG
CCTGGAGGACTCTTTCTCATCACTTCTTGTAATTTCACGGAGGAAGAGTTGAAGAGCAGCTTCATTACCGAGGAG
ACCGGACTTCAATATCATTCTCGTATTCAGCATCCAACATTTAGTTTTGGCGGCCGGTCCGGTAGTATCGTTTCT
AGTGTCGCATTCAAAAAACCACTGTGA
Transcript >AgabiH97|080900
ATGACTACGGAGCTACAGCCTTCAAAGCTTGGCACAAAGGAGCACTGGGACAAAGTCTACTCTGAAGAACTTACT
AATTTCGAAGAGATCGGTGATGAGGGCGAAATTTGGTTTGGTGAAGAGTCAATTGAGAAGATGGTCGACTGGTGC
CTCATGCATGTGCCTTCCTTATCGAACCCAGCCGTTCTGGAAGTGGGTAGTGGAAACGGAGCCCTGCTATTTGCG
CTTGCAGAAGCTGGTTATTCTCAGAAGCTTCTGATTGGAATCGACTACAGTGACGATGCCGTCAAGTTATCCACA
AAAATTTCAGCAACCCGTAACGCGACAGAAATCATGTTCAGCGTATGCGATTTCCTGCGAGAAGACCCGAGCCTT
CCATCGAGCCCAGAACACAGCAATGCACCAAGCTGTTGGGACCTCGTCCTGGATAAAGGCACATATGATGCTATC
GCTTTGGGCTCAAAAGACCCAAGTGGAAGGTCTCCCGCAGGAGCTTATCCACACCGGCTTTGCCGGCTGCTCAAG
CCTGGAGGACTCTTTCTCATCACTTCTTGTAATTTCACGGAGGAAGAGTTGAAGAGCAGCTTCATTACCGAGGAG
ACCGGACTTCAATATCATTCTCGTATTCAGCATCCAACATTTAGTTTTGGCGGCCGGTCCGGTAGTATCGTTTCT
AGTGTCGCATTCAAAAAACCACTGTGA
Gene >AgabiH97|080900
ATGACTACGGAGCTACAGCCTTCAAAGCTTGGCACAAAGGAGCAGTATGTGTTTGAAGTGTAAAGCTTTCACCCA
TACTCTCAAGCTATCAACAGCTGGGACAAAGTCTACTCTGAAGAACTTACTAATTTCGAAGAGATCGGTGATGAG
GGCGAAATTTGGTTCGCCACTCTCCATTCCTTATCGGCTACCGATCTCAAAACTCATGGCGACTAGGTTTGGTGA
AGAGTCAATTGAGAAGATGGTCGACTGGTGCCTCATGCATGTGCCTTCCTTATCGAACCCAGCCGTTCTGGAAGT
GGGTAGTGGAAACGGAGCCCTGCTATTTGCGCTTGCAGAAGCTGGTTATTCTCAGAAGCTTCTGATTGGAATCGA
CTACAGTGACGATGCCGTCAAGTTATCCACAAAAATTTCAGCAACCCGTAACGCGACAGAAATCATGTTCAGCGT
ATGCGATTTCCTGCGAGAAGACCCGAGCCTTCCATCGAGCCCAGAACACAGCAATGCACCAAGCTGTTGGGACCT
CGTCCTGGATAAAGGCACATATGATGCTATCGCTTTGGGCTCAAAAGACCCAAGTGGAAGGTCTCCCGCAGGAGC
TTATCCACACCGGCTTTGCCGGCTGCTCAAGCCTGGAGGACTCTTTCTCATCACTTGTACGAGTAAATGCCCTAA
ACAACCTGCAGATGCCCTAACTCGTGATGCGCAGCTTGTAATTTCACGGAGGAAGAGTTGAAGAGCAGCTTCATT
ACCGAGGAGACCGGACTTCAATATCAGTCAGTCGCGCCGTACCCATTGCCACTATCACATCCTTGAAAACTGACC
ACTATCATATTAGTTCTCGTATTCAGCATCCAACATTTAGTTTTGGCGGCCGGTCCGGTAGTATCGTTTCTAGTG
TCGCATTCAAAAAACCACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail