Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080800
Gene name
Locationscaffold_5:708104..709618
Strand+
Gene length (bp)1514
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01556 DnaJ_C DnaJ C terminal domain 2.0E-19 249 401
PF00226 DnaJ DnaJ domain 1.6E-16 55 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 55 106 2.0E-11
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 55 106 3.0E-11
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 250 401 5.0E-11
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 55 106 6.0E-11
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 55 106 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 55 106 2.0E-11
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 55 106 3.0E-11
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 250 401 5.0E-11
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 55 106 6.0E-11
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 55 106 3.0E-10
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 55 106 3.0E-10
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 55 106 3.0E-10
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 55 106 3.0E-10
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 55 343 4.0E-10
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 250 401 5.0E-10
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 55 402 5.0E-10
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 55 134 6.0E-10
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 55 134 7.0E-10
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 55 134 7.0E-10
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 55 106 7.0E-10
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 55 106 8.0E-10
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 55 106 9.0E-10
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 55 106 1.0E-09
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 55 356 1.0E-09
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 55 356 1.0E-09
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 55 356 1.0E-09
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 50 106 1.0E-09
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 55 106 1.0E-09
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 55 106 1.0E-09
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 275 401 2.0E-09
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 55 106 2.0E-09
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 55 110 2.0E-09
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 52 107 3.0E-09
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 52 107 3.0E-09
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 55 406 3.0E-09
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 52 130 4.0E-09
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 55 106 7.0E-09
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 50 109 1.0E-08
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 55 111 1.0E-08
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 55 106 1.0E-08
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 55 106 1.0E-08
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 52 109 2.0E-08
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 55 106 2.0E-08
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 55 106 2.0E-08
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 50 106 2.0E-08
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 55 106 2.0E-08
sp|Q5RBD7|DJC22_PONAB DnaJ homolog subfamily C member 22 OS=Pongo abelii GN=DNAJC22 PE=2 SV=1 54 116 3.0E-08
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 55 106 4.0E-08
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 55 106 4.0E-08
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 55 106 4.0E-08
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 50 109 4.0E-08
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 55 106 5.0E-08
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 55 106 5.0E-08
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 55 106 5.0E-08
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 50 106 6.0E-08
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 52 144 6.0E-08
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 55 110 6.0E-08
sp|Q8N4W6|DJC22_HUMAN DnaJ homolog subfamily C member 22 OS=Homo sapiens GN=DNAJC22 PE=2 SV=1 54 116 6.0E-08
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 55 106 7.0E-08
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 55 106 7.0E-08
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 55 106 8.0E-08
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 55 110 9.0E-08
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 55 110 9.0E-08
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 55 110 9.0E-08
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 55 106 9.0E-08
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 50 106 1.0E-07
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 55 106 1.0E-07
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 55 106 1.0E-07
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 55 106 1.0E-07
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 55 106 1.0E-07
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 55 106 1.0E-07
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 55 106 1.0E-07
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 55 106 1.0E-07
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 55 107 1.0E-07
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q7M9T3|DNAJ_WOLSU Chaperone protein DnaJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaJ PE=3 SV=1 55 109 1.0E-07
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 55 147 1.0E-07
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 55 110 1.0E-07
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 50 106 1.0E-07
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 55 106 1.0E-07
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 55 132 2.0E-07
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 55 106 2.0E-07
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 50 109 2.0E-07
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 55 106 2.0E-07
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 50 106 2.0E-07
sp|Q9SDN0|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic OS=Arabidopsis thaliana GN=ATJ20 PE=1 SV=2 55 106 2.0E-07
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 55 106 2.0E-07
sp|Q6XL73|DNJ39_ARATH Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2 55 106 2.0E-07
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 50 106 2.0E-07
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 55 110 3.0E-07
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 50 106 3.0E-07
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 55 106 3.0E-07
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 55 106 3.0E-07
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 55 106 3.0E-07
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 50 109 3.0E-07
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 50 106 3.0E-07
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 55 106 3.0E-07
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 55 106 3.0E-07
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 55 110 3.0E-07
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 55 106 3.0E-07
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 55 106 4.0E-07
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 50 109 4.0E-07
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 55 106 4.0E-07
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 52 106 4.0E-07
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 50 109 4.0E-07
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 55 106 4.0E-07
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 55 106 4.0E-07
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 53 106 4.0E-07
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 53 106 4.0E-07
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 55 106 4.0E-07
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 38 106 4.0E-07
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 38 106 4.0E-07
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 38 106 4.0E-07
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 38 106 4.0E-07
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 55 110 4.0E-07
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 55 110 5.0E-07
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 55 106 5.0E-07
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 55 123 6.0E-07
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|Q8SRK0|MAS5_ENCCU Mitochondrial protein import protein mas5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=MAS5 PE=1 SV=1 278 338 6.0E-07
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 55 106 6.0E-07
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 55 110 7.0E-07
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 55 110 7.0E-07
sp|A9ULE9|DJC22_XENTR DnaJ homolog subfamily C member 22 OS=Xenopus tropicalis GN=dnajc22 PE=2 SV=1 56 110 7.0E-07
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 55 149 7.0E-07
sp|Q6HDK8|DNAJ_BACHK Chaperone protein DnaJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|Q81LS3|DNAJ_BACAN Chaperone protein DnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|C3L5R6|DNAJ_BACAC Chaperone protein DnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|C3P8L9|DNAJ_BACAA Chaperone protein DnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 55 110 7.0E-07
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 55 106 7.0E-07
sp|B7JN38|DNAJ_BACC0 Chaperone protein DnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q634M8|DNAJ_BACCZ Chaperone protein DnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|C1ESK7|DNAJ_BACC3 Chaperone protein DnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|B9IY80|DNAJ_BACCQ Chaperone protein DnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|B7HPL2|DNAJ_BACC7 Chaperone protein DnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q730M2|DNAJ_BACC1 Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 55 106 8.0E-07
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 55 109 9.0E-07
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 55 106 9.0E-07
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 55 107 9.0E-07
sp|Q818F0|DNAJ_BACCR Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaJ PE=3 SV=1 55 106 9.0E-07
sp|D3ZD82|DNJ5B_RAT DnaJ homolog subfamily C member 5B OS=Rattus norvegicus GN=Dnajc5b PE=1 SV=1 38 106 9.0E-07
sp|B7HCT9|DNAJ_BACC4 Chaperone protein DnaJ OS=Bacillus cereus (strain B4264) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B7IYG6|DNAJ_BACC2 Chaperone protein DnaJ OS=Bacillus cereus (strain G9842) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 55 132 1.0E-06
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 55 132 1.0E-06
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|A9VHU0|DNAJ_BACWK Chaperone protein DnaJ OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q0WTI8|DNJ72_ARATH Chaperone protein dnaJ 72 OS=Arabidopsis thaliana GN=ATJ72 PE=2 SV=1 55 106 1.0E-06
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|O42196|DNJC5_XENLA DnaJ homolog subfamily C member 5 OS=Xenopus laevis GN=dnajc5 PE=2 SV=1 38 106 1.0E-06
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 50 106 1.0E-06
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 55 124 1.0E-06
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 55 106 1.0E-06
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 55 107 1.0E-06
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 50 106 1.0E-06
sp|Q03751|DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster GN=Csp PE=1 SV=1 55 109 1.0E-06
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 49 106 1.0E-06
sp|Q5PR00|DJC22_RAT DnaJ homolog subfamily C member 22 OS=Rattus norvegicus GN=Dnajc22 PE=2 SV=1 54 118 1.0E-06
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 55 106 1.0E-06
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 55 110 1.0E-06
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 55 110 2.0E-06
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 55 110 2.0E-06
sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens GN=DNAJC5B PE=1 SV=2 38 106 2.0E-06
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 49 106 2.0E-06
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 55 110 2.0E-06
sp|P56101|DNJC5_TORCA DnaJ homolog subfamily C member 5 OS=Torpedo californica GN=dnajc5 PE=1 SV=1 39 106 2.0E-06
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|Q8CHS2|DJC22_MOUSE DnaJ homolog subfamily C member 22 OS=Mus musculus GN=Dnajc22 PE=1 SV=1 54 118 2.0E-06
sp|Q7VG06|DNAJ_HELHP Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|B0RVU1|DNAJ_XANCB Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 50 106 2.0E-06
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|Q9LYW9|DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana GN=P58IPK PE=1 SV=1 55 112 2.0E-06
sp|Q8PAK8|DNAJ_XANCP Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|Q4UT12|DNAJ_XANC8 Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|O85213|DNAJ_CAMJE Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaJ PE=3 SV=2 50 106 2.0E-06
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|A7H2C0|DNAJ_CAMJD Chaperone protein DnaJ OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaJ PE=3 SV=1 50 106 2.0E-06
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|B8DQW8|DNAJ_DESVM Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 50 126 2.0E-06
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 55 106 2.0E-06
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 34 109 3.0E-06
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 50 106 3.0E-06
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 55 149 3.0E-06
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 55 109 3.0E-06
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 55 106 3.0E-06
sp|B4SSQ7|DNAJ_STRM5 Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaJ PE=3 SV=1 55 106 3.0E-06
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 55 106 3.0E-06
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 55 106 3.0E-06
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 55 106 3.0E-06
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 55 149 3.0E-06
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 50 106 3.0E-06
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 50 106 3.0E-06
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 50 106 3.0E-06
sp|A8EXP6|DNAJ_RICCK Chaperone protein DnaJ OS=Rickettsia canadensis (strain McKiel) GN=dnaJ PE=3 SV=1 50 145 3.0E-06
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 55 149 3.0E-06
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 50 106 4.0E-06
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 55 109 4.0E-06
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 55 110 4.0E-06
sp|Q75VW3|DNAJ_HYDTT Chaperone protein DnaJ OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=dnaJ PE=3 SV=1 55 109 4.0E-06
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 55 111 4.0E-06
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|Q17QW0|DJC22_BOVIN DnaJ homolog subfamily C member 22 OS=Bos taurus GN=DNAJC22 PE=2 SV=2 54 126 4.0E-06
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 55 106 4.0E-06
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 50 106 5.0E-06
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 55 106 5.0E-06
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 55 106 5.0E-06
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 55 106 5.0E-06
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 55 106 5.0E-06
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 51 106 6.0E-06
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 38 106 6.0E-06
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 55 106 6.0E-06
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 55 106 6.0E-06
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 55 106 6.0E-06
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 55 106 6.0E-06
sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus musculus GN=Dnajc5b PE=1 SV=1 43 106 6.0E-06
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 55 106 6.0E-06
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 55 106 6.0E-06
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 55 106 6.0E-06
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 38 106 7.0E-06
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 55 106 7.0E-06
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 55 106 7.0E-06
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 55 106 7.0E-06
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 240 401 8.0E-06
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 240 401 9.0E-06
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 55 107 9.0E-06
sp|Q9Y7T9|YCJD_SCHPO Uncharacterized J domain-containing protein C63.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC63.13 PE=3 SV=1 55 106 9.0E-06
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 55 106 1.0E-05
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 55 106 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080800
MKVITLQLPRSQNHGSSQACILEVETHQGQPRPSHSRCDIKGRTLRGSAMSSGSYNVLGLTPHATGEEIKQAYRA
MALRWHPDRHPADTENATQCFLEVQDAYQTLMRERFPLNPRSSSTLQGTEYASAYQTYQTRSNYSRSTSSVSSPT
QASSMSSDSAETPTSAVESNMSSCKCRFSGVGFQNGKGPAVVPHTPQYSRSFTIIPPAKKQYSPPQAMSSRDFYL
LHGRHQTVPLHSFGIGPSKEWIYGMALSLEDLLNGKLCSFSLSRVLVTGETKKVILDVEIPPGCREGTRIVCRGV
GHERKDRTRQDIVFIIEELNHEHFLRVGNDLVLEVKLPCDDYLRHRNGDFVVEGLDRQKHVFCVEYDRVLTGKHA
FTGSGMPIRHQGQVIGRGNLIVQWEIIPQHPRVFNFMKRFMHFRR*
Coding >AgabiH97|080800
ATGAAGGTCATCACGCTTCAATTGCCTAGGTCGCAGAATCATGGATCATCGCAGGCCTGTATTCTAGAAGTGGAA
ACACACCAGGGCCAACCGCGTCCCTCTCACAGTAGATGTGATATAAAGGGAAGAACTCTGCGTGGTAGTGCCATG
TCCTCAGGCTCATATAATGTCCTTGGGTTAACACCCCATGCCACAGGAGAAGAGATCAAGCAGGCATATAGAGCA
ATGGCACTGAGATGGCACCCTGATCGCCATCCTGCTGATACCGAAAATGCCACGCAATGCTTTCTTGAGGTTCAG
GATGCTTACCAGACGTTGATGCGAGAACGATTTCCCTTGAATCCGCGCTCATCTTCGACCCTCCAGGGCACAGAA
TATGCTTCTGCCTATCAAACATATCAGACCAGGTCGAATTACTCTAGATCAACGTCAAGTGTTAGTTCCCCCACC
CAGGCCTCGTCTATGAGTTCGGATTCCGCAGAGACGCCAACATCTGCAGTTGAGAGCAATATGTCATCGTGCAAG
TGTCGTTTTTCTGGGGTTGGGTTTCAAAATGGAAAGGGTCCAGCTGTCGTTCCTCACACACCACAATACTCCCGC
TCGTTCACCATCATCCCTCCGGCAAAGAAACAATATTCACCACCGCAAGCGATGAGTTCTCGGGATTTCTATCTT
TTGCATGGCCGCCATCAAACAGTTCCCCTCCATTCTTTTGGAATCGGCCCCTCAAAAGAATGGATATATGGAATG
GCACTTTCTCTGGAGGATTTACTGAACGGGAAGCTTTGCTCCTTCTCCCTATCTCGAGTGCTTGTTACCGGAGAA
ACAAAGAAAGTTATCCTGGATGTTGAAATTCCCCCCGGTTGTCGGGAGGGAACCAGGATCGTTTGTCGGGGTGTA
GGCCATGAGCGAAAGGATAGGACACGACAAGACATCGTGTTCATCATCGAGGAGCTTAATCATGAGCACTTCTTG
CGTGTTGGCAATGATTTGGTGTTAGAGGTTAAGCTTCCCTGTGACGATTATCTGCGCCATAGAAATGGAGATTTC
GTAGTTGAAGGTCTCGATCGGCAGAAGCATGTCTTTTGTGTTGAATACGATCGGGTATTGACAGGGAAACATGCC
TTTACGGGGTCTGGAATGCCGATCAGACATCAAGGACAAGTAATAGGTCGAGGAAACCTCATCGTCCAATGGGAA
ATAATACCACAACATCCTAGGGTTTTCAACTTTATGAAGCGATTCATGCACTTCCGGAGATGA
Transcript >AgabiH97|080800
ATGAAGGTCATCACGCTTCAATTGCCTAGGTCGCAGAATCATGGATCATCGCAGGCCTGTATTCTAGAAGTGGAA
ACACACCAGGGCCAACCGCGTCCCTCTCACAGTAGATGTGATATAAAGGGAAGAACTCTGCGTGGTAGTGCCATG
TCCTCAGGCTCATATAATGTCCTTGGGTTAACACCCCATGCCACAGGAGAAGAGATCAAGCAGGCATATAGAGCA
ATGGCACTGAGATGGCACCCTGATCGCCATCCTGCTGATACCGAAAATGCCACGCAATGCTTTCTTGAGGTTCAG
GATGCTTACCAGACGTTGATGCGAGAACGATTTCCCTTGAATCCGCGCTCATCTTCGACCCTCCAGGGCACAGAA
TATGCTTCTGCCTATCAAACATATCAGACCAGGTCGAATTACTCTAGATCAACGTCAAGTGTTAGTTCCCCCACC
CAGGCCTCGTCTATGAGTTCGGATTCCGCAGAGACGCCAACATCTGCAGTTGAGAGCAATATGTCATCGTGCAAG
TGTCGTTTTTCTGGGGTTGGGTTTCAAAATGGAAAGGGTCCAGCTGTCGTTCCTCACACACCACAATACTCCCGC
TCGTTCACCATCATCCCTCCGGCAAAGAAACAATATTCACCACCGCAAGCGATGAGTTCTCGGGATTTCTATCTT
TTGCATGGCCGCCATCAAACAGTTCCCCTCCATTCTTTTGGAATCGGCCCCTCAAAAGAATGGATATATGGAATG
GCACTTTCTCTGGAGGATTTACTGAACGGGAAGCTTTGCTCCTTCTCCCTATCTCGAGTGCTTGTTACCGGAGAA
ACAAAGAAAGTTATCCTGGATGTTGAAATTCCCCCCGGTTGTCGGGAGGGAACCAGGATCGTTTGTCGGGGTGTA
GGCCATGAGCGAAAGGATAGGACACGACAAGACATCGTGTTCATCATCGAGGAGCTTAATCATGAGCACTTCTTG
CGTGTTGGCAATGATTTGGTGTTAGAGGTTAAGCTTCCCTGTGACGATTATCTGCGCCATAGAAATGGAGATTTC
GTAGTTGAAGGTCTCGATCGGCAGAAGCATGTCTTTTGTGTTGAATACGATCGGGTATTGACAGGGAAACATGCC
TTTACGGGGTCTGGAATGCCGATCAGACATCAAGGACAAGTAATAGGTCGAGGAAACCTCATCGTCCAATGGGAA
ATAATACCACAACATCCTAGGGTTTTCAACTTTATGAAGCGATTCATGCACTTCCGGAGATGA
Gene >AgabiH97|080800
ATGAAGGTCATCACGCTTCAATTGCCTAGGTCGCAGAATCATGGATCATCGCAGGCCTGTATTCTAGAAGTGGAA
ACACACCAGGGCCAACCGCGTCCCTCTCACAGTAGATGTGATATAAAGGGAAGAACTCTGCGGTACTGTCAGTCT
CCCCTGGCTGATAAGCAGGGGTTAATAACCTCCAGTGGTAGTGCCATGTCCTCAGGCTCATATAATGTCCTTGGG
TTAACACCCCATGCCACAGGAGAAGAGATCAAGCAGGCATATAGAGCAATGGTAAGGGACACCATCTTCACAGCC
ACGATCTTGCATGCTCACGAGGTATTGAGGCACTGAGATGGCACCCTGATCGCCATCCTGCTGATACCGAAAATG
CCACGCAATGCTTTCTTGAGGTAAGTTGAGAGGAAGTTGTTCATGCAGCGTCGCTGACCCGCTGATAGGTTCAGG
ATGCTTACCAGACGTTGATGCGAGAACGATTTCCCTTGAATCCGCGCTCATCTTCGACCCTCCAGGGCACAGAAT
ATGCTTCTGCCTATCAAACATATCAGACCAGGTCGAATTACTCTAGATCAACGTCAAGTGTTAGTTCCCCCACCC
AGGCCTCGTCTATGAGTTCGGATTCCGCAGAGACGCCAACATCTGCAGTTGAGAGCAATATGTCATCGTGCAAGT
GTCGTTTTTCTGGGGTTGGGTTTCAAAATGGAAAGGGTCCAGCTGTCGTTCCTCACACACCACAATACTCGTAAG
CATTATTGTTTAAGTGTATAGGCCGACATCGTTAATCTACTGATAGCCGCTCGTTCACCATCATCCCTCCGGCAA
AGAAACAATATTCACCACCGCAAGCGATGAGTTCTCGGGATTTCTATCTTTTGCATGGCCGCCATCAAACAGTTC
CCCTCCATTCTTTTGGAATCGGCCCCTCAAAAGAATGGATATATGGAATGGCACTTTCTCTGGAGGATTTACTGA
ACGGGAAGCTTTGCTCCTTCTCCCTATCTCGAGTGCTTGTTACCGGAGAAACAAAGAAAGTTATCCTGGATGTTG
AAATTCCCCCCGGTTGTCGGGAGGGAACCAGGATCGTTTGTCGGGGTGTAGGCCATGAGCGAAAGGATAGGACAC
GACAAGACATCGTGTTCATCATCGAGGAGCTTAATCATGAGCACTTCTTGCGTGTTGGCAATGATTTGGTGTTAG
AGGTTAAGCTTCCCTGTGACGATTATCTGCGCCATAGAAATGGAGATTTCGTAGTTGAAGGTCTCGATCGGCAGA
AGCATGTCTTTTGTGTTGAATACGATCGGGTATTGACAGGGAAACATGCCTTTACGGGGTCTGGAATGCCGATCA
GACATCAAGGACAAGTAATAGGTCGAGGAAACCTCATCGTCCAGTATGTTTCTCTATGATCCATCGGCGTTAAGG
AGAGCTTATAAGCTTCTAGATGGGAAATAATACCACAACATCCTAGGGTTTTCAACTTTATGAAGCGATTCATGC
ACTTCCGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail