Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080770
Gene name
Locationscaffold_5:701691..704875
Strand-
Gene length (bp)3184
Transcript length (bp)3078
Coding sequence length (bp)3078
Protein length (aa) 1026

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 1.2E-05 217 268
PF01344 Kelch_1 Kelch motif 2.5E-04 218 261
PF13415 Kelch_3 Galactose oxidase, central domain 8.1E-06 226 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 41 313 1.0E-15
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 79 313 3.0E-14
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 79 313 9.0E-14
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 41 313 9.0E-13
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 81 313 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 41 313 1.0E-15
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 79 313 3.0E-14
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 79 313 9.0E-14
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 41 313 9.0E-13
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 81 313 3.0E-12
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 79 296 6.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 169 427 2.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 113 422 4.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 113 372 7.0E-06
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 187 371 7.0E-06
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 187 371 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 427 449 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080770
MNSLTTRCGVCLFNVLLIVLLSGQLAISYTPNPRWGQAVVQINDALFVYGGKTDLFNSYSYTSAPTTSDLLRLPL
SQPFDTATPPWELVNSSSTSQIPNVSWHTLSAFNYSSVLLFGGQPGTTSPIVTFDEADSACLLELSNSMQPTWYP
DVSWVGEPVRRIFHTSVTCPTTGRIYIVGGQTADGSQHLFPAHYIFDPRTLTFSVTPSNNGPPALYGHASVIFPD
GRMFVFGGIAEDTPIPLSDVWSLDTANKDSVWRKVPVNSSSLPQPRRAFAAVAIGQGKILIQGGSDADLQNNMND
GWILDTSKDPAVWTEVTELAQVGARRDHYAILSNGLVIFGFGYLDSGPAPAGVQIFDPSHNTYPLSYLPPSPSAS
ITQTMPGPTATVSGTGAYPTGLVTSTSTGITQPGSVPTAEPGENVSDKKKSIIAIAVGTLFGVLGAAALGFFVFA
YVRRRRRKNGGLFMVIEDDNDGNGGNLRGRPLMPAAIRHDEKEAPGMSGWANNLLDTAFGITGTARSHNPRHTHQ
RRDMLADEDTRDFGEWYNARRRDGTGGSSWSLMSVFGGRFRSRDASIFSYGSHHQERTDPFSDGISLIQDREPEP
SHLEGKERSRHGGEVSYRTTSNYSYIDPFDDPFPEERQSENQQELSRNREDTDNGLATAATMISRPQITMSTLRM
VSPLSMAAYPLSPLLEYTPNTIDSDHGQTTFSHTQSSGTLVGTNESLTTSQTSSEPFRSSSKPTIESPMSPKLLP
FTSIVPANMSPSGIRRSDSWWSRFYRTSFLDRRSSSASHRSNILDIRDPNPPPPLVPIVESTSSVSGEEISLNSA
DDADGSRQISRSQSRVYKIGPGKSMTSLRTADTEQIEKLAVDMDVVQRVRTPSQTTSDSTNSGLGINACKLAGSD
HNEQSELGVISSSPTERVLLSDTISHDSPPPAVHTSIVPVSPTLSLTSYQSPPSTPAPKPSVADRVKMYERRMSQ
DQERLSPTNTKNLEERSPNKERVTVNYGLAPRANLFVANPDHRNSRSSDS*
Coding >AgabiH97|080770
ATGAATTCGCTTACGACGCGATGTGGGGTATGCTTGTTCAACGTACTCCTCATTGTACTTTTATCAGGTCAATTA
GCTATCTCCTATACTCCAAATCCACGATGGGGTCAAGCTGTCGTTCAAATCAATGATGCTTTGTTCGTCTATGGA
GGCAAGACAGATCTATTCAACTCATATTCATACACCTCTGCTCCGACTACAAGCGACCTACTTCGCCTTCCGCTC
TCACAACCTTTTGACACCGCCACTCCGCCATGGGAACTAGTGAACAGTTCCAGCACTTCTCAAATTCCTAACGTA
TCATGGCATACACTCTCTGCCTTCAATTACTCTAGCGTACTACTTTTCGGAGGTCAACCCGGTACTACCTCGCCT
ATCGTGACCTTTGATGAAGCCGATTCTGCATGCCTTCTGGAGCTTTCAAACTCCATGCAGCCCACCTGGTATCCC
GATGTATCATGGGTCGGGGAACCTGTTCGCAGGATATTCCACACCTCTGTGACATGTCCCACTACCGGCAGGATC
TACATAGTTGGAGGACAGACAGCCGATGGCTCCCAGCATTTGTTTCCCGCTCACTATATATTCGACCCTCGTACC
CTCACGTTTTCCGTAACACCTTCCAACAATGGCCCGCCCGCACTCTACGGTCATGCCTCTGTTATCTTTCCAGAC
GGTCGAATGTTCGTATTTGGTGGCATTGCTGAAGATACTCCAATTCCGCTTTCGGATGTCTGGTCACTTGACACT
GCCAATAAGGATTCTGTCTGGAGAAAGGTGCCGGTGAATTCTAGCTCACTTCCTCAGCCCCGGAGAGCATTCGCT
GCGGTCGCCATAGGCCAAGGGAAAATTCTTATCCAGGGTGGCAGTGATGCTGACCTTCAGAATAACATGAACGAT
GGATGGATTCTAGACACTTCGAAAGACCCCGCGGTATGGACTGAAGTTACGGAGTTAGCACAAGTTGGTGCCCGG
CGTGATCATTATGCAATTCTGTCAAACGGTTTGGTCATTTTCGGTTTTGGCTATCTGGATTCTGGGCCTGCACCA
GCAGGTGTTCAGATATTTGATCCCTCCCATAATACTTATCCTCTTTCTTATTTGCCCCCATCGCCTTCTGCTTCA
ATTACTCAGACAATGCCTGGTCCCACAGCTACAGTTTCAGGAACAGGCGCTTACCCTACAGGCTTAGTAACATCA
ACAAGCACTGGCATCACTCAACCCGGCTCGGTACCCACGGCTGAACCGGGAGAGAACGTGAGTGACAAGAAAAAG
TCTATCATAGCTATCGCTGTCGGGACTCTATTCGGCGTGCTTGGGGCTGCTGCACTCGGATTCTTTGTCTTCGCA
TACGTTCGTCGGCGGCGGAGAAAGAACGGAGGACTATTCATGGTTATTGAAGATGATAACGATGGCAATGGCGGT
AACCTTCGTGGCCGCCCCCTTATGCCGGCTGCCATTCGGCATGATGAGAAAGAAGCGCCAGGCATGAGCGGATGG
GCCAACAACCTGTTGGATACCGCTTTCGGTATTACAGGAACCGCAAGATCACACAATCCGAGACACACGCACCAA
CGTAGGGACATGTTAGCAGACGAAGATACGAGGGACTTCGGGGAGTGGTATAATGCCAGACGCAGGGACGGTACT
GGAGGGAGTTCATGGTCTTTGATGAGCGTTTTCGGCGGCCGTTTCAGGAGTCGTGATGCCAGTATTTTCAGTTAT
GGTAGTCACCATCAGGAAAGGACGGATCCGTTCTCAGATGGGATATCCCTTATTCAGGATCGGGAGCCGGAACCC
TCCCATCTAGAAGGCAAGGAGCGCTCTCGCCATGGAGGGGAGGTCAGCTACCGCACGACAAGCAATTACAGCTAT
ATCGATCCCTTTGATGACCCATTCCCAGAGGAAAGACAAAGCGAAAATCAGCAGGAGCTCAGCAGAAATAGAGAA
GATACTGATAACGGGTTAGCAACTGCGGCGACCATGATATCACGTCCTCAGATCACGATGTCCACACTCCGGATG
GTTTCCCCCTTGTCGATGGCCGCATACCCTTTGAGCCCTTTATTGGAATATACGCCGAATACCATTGATTCTGAC
CATGGTCAAACAACTTTTTCTCATACACAATCCAGCGGGACCCTCGTTGGGACAAACGAGTCACTGACCACATCA
CAAACAAGCTCAGAACCATTCCGCTCCAGCTCGAAGCCAACTATCGAGTCCCCCATGTCACCCAAGTTACTACCG
TTCACATCCATTGTACCCGCCAATATGTCGCCATCAGGTATTCGTAGGAGTGATTCGTGGTGGTCCCGATTTTAT
CGTACAAGTTTCCTCGATCGCCGATCTTCTTCCGCGTCACATCGTTCAAATATTCTTGACATCCGTGATCCTAAT
CCTCCTCCTCCTCTTGTCCCCATTGTAGAAAGCACCTCTTCTGTCTCTGGAGAAGAGATATCTTTGAACTCGGCC
GATGACGCGGATGGTTCAAGACAAATATCGAGATCGCAATCAAGAGTCTATAAAATTGGTCCTGGAAAGTCTATG
ACATCGCTTCGTACAGCAGATACCGAGCAAATTGAAAAGTTGGCTGTGGATATGGACGTTGTGCAACGAGTGCGG
ACACCAAGTCAGACGACGAGCGATAGCACTAACAGCGGATTGGGCATCAATGCCTGCAAATTAGCAGGAAGTGAC
CATAATGAACAAAGCGAGCTTGGGGTCATCTCTTCATCTCCTACTGAAAGAGTATTGTTGTCTGACACTATATCT
CATGATTCACCTCCGCCAGCGGTTCATACATCTATTGTGCCAGTTTCTCCTACTCTATCGCTCACATCATATCAA
TCTCCCCCTTCTACTCCGGCTCCAAAACCATCAGTCGCTGACCGTGTTAAAATGTACGAACGCAGGATGTCTCAG
GACCAAGAACGACTTTCGCCGACCAATACCAAGAACTTAGAAGAAAGATCGCCGAACAAAGAGAGGGTTACAGTC
AACTACGGCCTTGCACCTCGTGCGAATCTATTCGTTGCTAACCCCGACCATCGTAACTCGCGTTCAAGCGACTCA
TGA
Transcript >AgabiH97|080770
ATGAATTCGCTTACGACGCGATGTGGGGTATGCTTGTTCAACGTACTCCTCATTGTACTTTTATCAGGTCAATTA
GCTATCTCCTATACTCCAAATCCACGATGGGGTCAAGCTGTCGTTCAAATCAATGATGCTTTGTTCGTCTATGGA
GGCAAGACAGATCTATTCAACTCATATTCATACACCTCTGCTCCGACTACAAGCGACCTACTTCGCCTTCCGCTC
TCACAACCTTTTGACACCGCCACTCCGCCATGGGAACTAGTGAACAGTTCCAGCACTTCTCAAATTCCTAACGTA
TCATGGCATACACTCTCTGCCTTCAATTACTCTAGCGTACTACTTTTCGGAGGTCAACCCGGTACTACCTCGCCT
ATCGTGACCTTTGATGAAGCCGATTCTGCATGCCTTCTGGAGCTTTCAAACTCCATGCAGCCCACCTGGTATCCC
GATGTATCATGGGTCGGGGAACCTGTTCGCAGGATATTCCACACCTCTGTGACATGTCCCACTACCGGCAGGATC
TACATAGTTGGAGGACAGACAGCCGATGGCTCCCAGCATTTGTTTCCCGCTCACTATATATTCGACCCTCGTACC
CTCACGTTTTCCGTAACACCTTCCAACAATGGCCCGCCCGCACTCTACGGTCATGCCTCTGTTATCTTTCCAGAC
GGTCGAATGTTCGTATTTGGTGGCATTGCTGAAGATACTCCAATTCCGCTTTCGGATGTCTGGTCACTTGACACT
GCCAATAAGGATTCTGTCTGGAGAAAGGTGCCGGTGAATTCTAGCTCACTTCCTCAGCCCCGGAGAGCATTCGCT
GCGGTCGCCATAGGCCAAGGGAAAATTCTTATCCAGGGTGGCAGTGATGCTGACCTTCAGAATAACATGAACGAT
GGATGGATTCTAGACACTTCGAAAGACCCCGCGGTATGGACTGAAGTTACGGAGTTAGCACAAGTTGGTGCCCGG
CGTGATCATTATGCAATTCTGTCAAACGGTTTGGTCATTTTCGGTTTTGGCTATCTGGATTCTGGGCCTGCACCA
GCAGGTGTTCAGATATTTGATCCCTCCCATAATACTTATCCTCTTTCTTATTTGCCCCCATCGCCTTCTGCTTCA
ATTACTCAGACAATGCCTGGTCCCACAGCTACAGTTTCAGGAACAGGCGCTTACCCTACAGGCTTAGTAACATCA
ACAAGCACTGGCATCACTCAACCCGGCTCGGTACCCACGGCTGAACCGGGAGAGAACGTGAGTGACAAGAAAAAG
TCTATCATAGCTATCGCTGTCGGGACTCTATTCGGCGTGCTTGGGGCTGCTGCACTCGGATTCTTTGTCTTCGCA
TACGTTCGTCGGCGGCGGAGAAAGAACGGAGGACTATTCATGGTTATTGAAGATGATAACGATGGCAATGGCGGT
AACCTTCGTGGCCGCCCCCTTATGCCGGCTGCCATTCGGCATGATGAGAAAGAAGCGCCAGGCATGAGCGGATGG
GCCAACAACCTGTTGGATACCGCTTTCGGTATTACAGGAACCGCAAGATCACACAATCCGAGACACACGCACCAA
CGTAGGGACATGTTAGCAGACGAAGATACGAGGGACTTCGGGGAGTGGTATAATGCCAGACGCAGGGACGGTACT
GGAGGGAGTTCATGGTCTTTGATGAGCGTTTTCGGCGGCCGTTTCAGGAGTCGTGATGCCAGTATTTTCAGTTAT
GGTAGTCACCATCAGGAAAGGACGGATCCGTTCTCAGATGGGATATCCCTTATTCAGGATCGGGAGCCGGAACCC
TCCCATCTAGAAGGCAAGGAGCGCTCTCGCCATGGAGGGGAGGTCAGCTACCGCACGACAAGCAATTACAGCTAT
ATCGATCCCTTTGATGACCCATTCCCAGAGGAAAGACAAAGCGAAAATCAGCAGGAGCTCAGCAGAAATAGAGAA
GATACTGATAACGGGTTAGCAACTGCGGCGACCATGATATCACGTCCTCAGATCACGATGTCCACACTCCGGATG
GTTTCCCCCTTGTCGATGGCCGCATACCCTTTGAGCCCTTTATTGGAATATACGCCGAATACCATTGATTCTGAC
CATGGTCAAACAACTTTTTCTCATACACAATCCAGCGGGACCCTCGTTGGGACAAACGAGTCACTGACCACATCA
CAAACAAGCTCAGAACCATTCCGCTCCAGCTCGAAGCCAACTATCGAGTCCCCCATGTCACCCAAGTTACTACCG
TTCACATCCATTGTACCCGCCAATATGTCGCCATCAGGTATTCGTAGGAGTGATTCGTGGTGGTCCCGATTTTAT
CGTACAAGTTTCCTCGATCGCCGATCTTCTTCCGCGTCACATCGTTCAAATATTCTTGACATCCGTGATCCTAAT
CCTCCTCCTCCTCTTGTCCCCATTGTAGAAAGCACCTCTTCTGTCTCTGGAGAAGAGATATCTTTGAACTCGGCC
GATGACGCGGATGGTTCAAGACAAATATCGAGATCGCAATCAAGAGTCTATAAAATTGGTCCTGGAAAGTCTATG
ACATCGCTTCGTACAGCAGATACCGAGCAAATTGAAAAGTTGGCTGTGGATATGGACGTTGTGCAACGAGTGCGG
ACACCAAGTCAGACGACGAGCGATAGCACTAACAGCGGATTGGGCATCAATGCCTGCAAATTAGCAGGAAGTGAC
CATAATGAACAAAGCGAGCTTGGGGTCATCTCTTCATCTCCTACTGAAAGAGTATTGTTGTCTGACACTATATCT
CATGATTCACCTCCGCCAGCGGTTCATACATCTATTGTGCCAGTTTCTCCTACTCTATCGCTCACATCATATCAA
TCTCCCCCTTCTACTCCGGCTCCAAAACCATCAGTCGCTGACCGTGTTAAAATGTACGAACGCAGGATGTCTCAG
GACCAAGAACGACTTTCGCCGACCAATACCAAGAACTTAGAAGAAAGATCGCCGAACAAAGAGAGGGTTACAGTC
AACTACGGCCTTGCACCTCGTGCGAATCTATTCGTTGCTAACCCCGACCATCGTAACTCGCGTTCAAGCGACTCA
TGA
Gene >AgabiH97|080770
ATGAATTCGCTTACGACGCGATGTGGGGTATGCTTGTTCAACGTACTCCTCATTGTACTTTTATCAGGTCAATTA
GCTATCTCCTATACTCCAAATCCACGGTATGTGCCAGCTATAAGGATGAATAGCTATATTCTTTCTGAGCATTTG
AGCTAGATGGGGTCAAGCTGTCGTTCAAATCAATGATGCTTTGTTCGTCTATGGAGGCAAGACAGATCTATTCAA
CTCATATTCATACACCTCTGCTCCGACTACAAGCGACCTACTTCGCCTTCCGCTCTCACAACCTTTTGACACCGC
CACTCCGCCATGGGAACTAGTGAACAGTTCCAGCACTTCTCAAATTCCTAACGTATCATGGCATACACTCTCTGC
CTTCAATTACTCTAGCGTACTACTTTTCGGAGGTCAACCCGGTACTACCTCGCCTATCGTGACCTTTGATGAAGC
CGATTCTGCATGCCTTCTGGAGCTTTCAAACTCCATGCAGCCCACCTGGTATCCCGATGTATCATGGGTCGGGGA
ACCTGTTCGCAGGATATTCCACACCTCTGTGACATGTCCCACTACCGGCAGGATCTACATAGTTGGAGGACAGAC
AGCCGATGGCTCCCAGCATTTGTTTCCCGCTCACTATATATTCGACCCTCGTACCCTCACGTTTTCCGTAACACC
TTCCAACAATGGCCCGCCCGCACTCTACGGTCATGCCTCTGTTATCTTTCCAGACGGTCGAATGTTCGTATTTGG
TGGCATTGCTGAAGATACTCCAATTCCGCTTTCGGATGTCTGGTCACTTGACACTGCCAATAAGGATTCTGTCTG
GAGAAAGGTGCCGGTGAATTCTAGCTCACTTCCTCAGCCCCGGAGAGCATTCGCTGCGGTCGCCATAGGCCAAGG
GAAAATTCTTATCCAGGGTGGCAGTGATGCTGACCTTCAGAATAACATGAACGATGGATGGATTCTAGACACTTC
GAAAGACCCCGCGGTATGGACTGAAGTTACGGAGTTAGCACAAGTTGGTGCCCGGCGTGATCATTATGCAATTCT
GTCAAACGGTTTGGTCATTTTCGGTTTTGGTCTGTTTTCTCCTCGTCCCGATCTTTTAGCCTGTCTGACCTTTTC
CCTAGGCTATCTGGATTCTGGGCCTGCACCAGCAGGTGTTCAGATATTTGATCCCTCCCATAATACTTATCCTCT
TTCTTATTTGCCCCCATCGCCTTCTGCTTCAATTACTCAGACAATGCCTGGTCCCACAGCTACAGTTTCAGGAAC
AGGCGCTTACCCTACAGGCTTAGTAACATCAACAAGCACTGGCATCACTCAACCCGGCTCGGTACCCACGGCTGA
ACCGGGAGAGAACGTGAGTGACAAGAAAAAGTCTATCATAGCTATCGCTGTCGGGACTCTATTCGGCGTGCTTGG
GGCTGCTGCACTCGGATTCTTTGTCTTCGCATACGTTCGTCGGCGGCGGAGAAAGAACGGAGGACTATTCATGGT
TATTGAAGATGATAACGATGGCAATGGCGGTAACCTTCGTGGCCGCCCCCTTATGCCGGCTGCCATTCGGCATGA
TGAGAAAGAAGCGCCAGGCATGAGCGGATGGGCCAACAACCTGTTGGATACCGCTTTCGGTATTACAGGAACCGC
AAGATCACACAATCCGAGACACACGCACCAACGTAGGGACATGTTAGCAGACGAAGATACGAGGGACTTCGGGGA
GTGGTATAATGCCAGACGCAGGGACGGTACTGGAGGGAGTTCATGGTCTTTGATGAGCGTTTTCGGCGGCCGTTT
CAGGAGTCGTGATGCCAGTATTTTCAGTTATGGTAGTCACCATCAGGAAAGGACGGATCCGTTCTCAGATGGGAT
ATCCCTTATTCAGGATCGGGAGCCGGAACCCTCCCATCTAGAAGGCAAGGAGCGCTCTCGCCATGGAGGGGAGGT
CAGCTACCGCACGACAAGCAATTACAGCTATATCGATCCCTTTGATGACCCATTCCCAGAGGAAAGACAAAGCGA
AAATCAGCAGGAGCTCAGCAGAAATAGAGAAGATACTGATAACGGGTTAGCAACTGCGGCGACCATGATATCACG
TCCTCAGATCACGATGTCCACACTCCGGATGGTTTCCCCCTTGTCGATGGCCGCATACCCTTTGAGCCCTTTATT
GGAATATACGCCGAATACCATTGATTCTGACCATGGTCAAACAACTTTTTCTCATACACAATCCAGCGGGACCCT
CGTTGGGACAAACGAGTCACTGACCACATCACAAACAAGCTCAGAACCATTCCGCTCCAGCTCGAAGCCAACTAT
CGAGTCCCCCATGTCACCCAAGTTACTACCGTTCACATCCATTGTACCCGCCAATATGTCGCCATCAGGTATTCG
TAGGAGTGATTCGTGGTGGTCCCGATTTTATCGTACAAGTTTCCTCGATCGCCGATCTTCTTCCGCGTCACATCG
TTCAAATATTCTTGACATCCGTGATCCTAATCCTCCTCCTCCTCTTGTCCCCATTGTAGAAAGCACCTCTTCTGT
CTCTGGAGAAGAGATATCTTTGAACTCGGCCGATGACGCGGATGGTTCAAGACAAATATCGAGATCGCAATCAAG
AGTCTATAAAATTGGTCCTGGAAAGTCTATGACATCGCTTCGTACAGCAGATACCGAGCAAATTGAAAAGTTGGC
TGTGGATATGGACGTTGTGCAACGAGTGCGGACACCAAGTCAGACGACGAGCGATAGCACTAACAGCGGATTGGG
CATCAATGCCTGCAAATTAGCAGGAAGTGACCATAATGAACAAAGCGAGCTTGGGGTCATCTCTTCATCTCCTAC
TGAAAGAGTATTGTTGTCTGACACTATATCTCATGATTCACCTCCGCCAGCGGTTCATACATCTATTGTGCCAGT
TTCTCCTACTCTATCGCTCACATCATATCAATCTCCCCCTTCTACTCCGGCTCCAAAACCATCAGTCGCTGACCG
TGTTAAAATGTACGAACGCAGGATGTCTCAGGACCAAGAACGACTTTCGCCGACCAATACCAAGAACTTAGAAGA
AAGATCGCCGAACAAAGAGAGGGTTACAGTCAACTACGGCCTTGCACCTCGTGCGAATCTATTCGTTGCTAACCC
CGACCATCGTAACTCGCGTTCAAGCGACTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail