Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080740
Gene name
Locationscaffold_5:690015..691784
Strand-
Gene length (bp)1769
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00169 PH PH domain 5.1E-17 117 208
PF00169 PH PH domain 9.4E-11 309 443

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HB21|PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens GN=PLEKHA1 PE=1 SV=2 116 210 3.0E-14
sp|Q8BUL6|PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus GN=Plekha1 PE=1 SV=1 116 210 5.0E-14
sp|Q9ERS5|PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus GN=Plekha2 PE=1 SV=1 117 205 1.0E-13
sp|Q9HB19|PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens GN=PLEKHA2 PE=1 SV=2 117 220 3.0E-13
sp|Q3ZBA3|PKHA2_BOVIN Pleckstrin homology domain-containing family A member 2 OS=Bos taurus GN=PLEKHA2 PE=2 SV=1 117 205 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HB21|PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens GN=PLEKHA1 PE=1 SV=2 116 210 3.0E-14
sp|Q8BUL6|PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus GN=Plekha1 PE=1 SV=1 116 210 5.0E-14
sp|Q9ERS5|PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus GN=Plekha2 PE=1 SV=1 117 205 1.0E-13
sp|Q9HB19|PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens GN=PLEKHA2 PE=1 SV=2 117 220 3.0E-13
sp|Q3ZBA3|PKHA2_BOVIN Pleckstrin homology domain-containing family A member 2 OS=Bos taurus GN=PLEKHA2 PE=2 SV=1 117 205 6.0E-13
sp|Q9QXT1|DAPP1_MOUSE Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Mus musculus GN=Dapp1 PE=1 SV=1 118 205 2.0E-12
sp|Q9UN19|DAPP1_HUMAN Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Homo sapiens GN=DAPP1 PE=1 SV=1 118 205 3.0E-12
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 119 218 3.0E-11
sp|Q96WV2|YJO2_SCHPO Uncharacterized PH domain-containing protein PB16A4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB16A4.02c PE=3 SV=2 104 372 6.0E-11
sp|Q64398|DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus GN=DGKH PE=2 SV=1 60 209 2.0E-10
sp|Q80TI1|PKHH1_MOUSE Pleckstrin homology domain-containing family H member 1 OS=Mus musculus GN=Plekhh1 PE=1 SV=2 118 206 1.0E-09
sp|Q9ULM0|PKHH1_HUMAN Pleckstrin homology domain-containing family H member 1 OS=Homo sapiens GN=PLEKHH1 PE=2 SV=2 112 206 2.0E-09
sp|Q00IB7|PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio GN=plekhh1 PE=2 SV=1 83 206 7.0E-09
sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1 111 207 2.0E-08
sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1 111 207 2.0E-08
sp|Q9HD67|MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens GN=MYO10 PE=1 SV=3 111 211 2.0E-08
sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens GN=SWAP70 PE=1 SV=1 116 205 3.0E-08
sp|Q9QYY0|GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus GN=Gab1 PE=1 SV=2 117 223 4.0E-08
sp|Q9H4E7|DEFI6_HUMAN Differentially expressed in FDCP 6 homolog OS=Homo sapiens GN=DEF6 PE=1 SV=1 113 208 5.0E-08
sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1 111 211 8.0E-08
sp|P0C1G6|SWP70_BOVIN Switch-associated protein 70 OS=Bos taurus GN=SWAP70 PE=1 SV=1 116 205 8.0E-08
sp|Q86XP1|DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens GN=DGKH PE=1 SV=1 83 209 1.0E-07
sp|Q6A028|SWP70_MOUSE Switch-associated protein 70 OS=Mus musculus GN=Swap70 PE=1 SV=2 116 205 1.0E-07
sp|Q8C2K1|DEFI6_MOUSE Differentially expressed in FDCP 6 OS=Mus musculus GN=Def6 PE=1 SV=1 113 208 1.0E-07
sp|Q9UQC2|GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens GN=GAB2 PE=1 SV=1 117 205 2.0E-07
sp|A6QLU3|GAB1_BOVIN GRB2-associated-binding protein 1 OS=Bos taurus GN=GAB1 PE=2 SV=1 116 205 5.0E-07
sp|Q5F4B2|SWP70_CHICK Switch-associated protein 70 OS=Gallus gallus GN=SWAP70 PE=2 SV=1 116 206 6.0E-07
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum GN=kif1 PE=1 SV=1 119 209 6.0E-07
sp|Q9JHK5|PLEK_MOUSE Pleckstrin OS=Mus musculus GN=Plek PE=1 SV=1 111 211 7.0E-07
sp|Q9NYT0|PLEK2_HUMAN Pleckstrin-2 OS=Homo sapiens GN=PLEK2 PE=1 SV=1 103 207 8.0E-07
sp|Q8C115|PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus GN=Plekhh2 PE=1 SV=3 118 206 9.0E-07
sp|Q8BSM5|GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus GN=Gab3 PE=1 SV=1 116 208 1.0E-06
sp|Q6Q308|PLEK_CANLF Pleckstrin OS=Canis lupus familiaris GN=PLEK PE=2 SV=1 103 211 1.0E-06
sp|Q9WV52|PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus GN=Plek2 PE=1 SV=1 103 207 2.0E-06
sp|Q86IV4|Y4775_DICDI PH domain-containing protein DDB_G0274775 OS=Dictyostelium discoideum GN=DDB_G0274775 PE=3 SV=1 118 206 2.0E-06
sp|B4JHJ7|DGKH_DROGR Diacylglycerol kinase eta OS=Drosophila grimshawi GN=GH18973 PE=3 SV=1 115 208 2.0E-06
sp|Q7SYB5|DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio GN=def6 PE=2 SV=1 113 208 3.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 118 206 3.0E-06
sp|Q9W5D0|Y34F_DROME Uncharacterized protein CG43867 OS=Drosophila melanogaster GN=CG43867 PE=1 SV=4 111 209 3.0E-06
sp|P08567|PLEK_HUMAN Pleckstrin OS=Homo sapiens GN=PLEK PE=1 SV=3 103 211 3.0E-06
sp|Q8IVE3|PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens GN=PLEKHH2 PE=1 SV=2 118 206 5.0E-06
sp|Q2WGN9|GAB4_HUMAN GRB2-associated-binding protein 4 OS=Homo sapiens GN=GAB4 PE=2 SV=1 116 205 7.0E-06
sp|Q1ZXL0|Y5795_DICDI PH domain-containing protein DDB_G0275795 OS=Dictyostelium discoideum GN=DDB_G0275795 PE=3 SV=1 117 209 8.0E-06
sp|Q6PA69|DEFI6_XENLA Differentially expressed in FDCP 6 homolog OS=Xenopus laevis GN=def6 PE=2 SV=1 113 208 8.0E-06
sp|Q7S1I0|ATG26_NEUCR Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-12 PE=3 SV=1 107 206 8.0E-06
sp|Q4KM33|PLEK_RAT Pleckstrin OS=Rattus norvegicus GN=Plek PE=1 SV=1 103 211 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080740
MSPSAAPPTPLEVQRKLSVHSATHPIKVSPSMPFLNTTVSGTESDSDSILTPDVGISSSHTPGGAAVSHTIPPPL
SSIAEQSPGSGAEDSDEEEEEGGWQMGEDVAAKTPRGVDTTIKSGYLAKKGARRKTWKKRWFVLRPSHLAFYKTE
AEYKLLRLLDLADVHSCTPVHLKRHDNAFGLILPKRTYYLQAGSAKDAQAWVEAIEEARVTLMTTSTQTSTNSNA
IPIPGAARTSFFHGSVPISSSPQNMDHVNSSDSEDALSVGAPSPPSPPPPPPPMVSSSPGVEGQRGNMQNVTFSV
SPSKPSPPVILSGYLMKCGSKRRNWRKRWFVLSSDKLIYSRSHMDIKPHRMFTLNDILDAMDYDMPVHRHHHHHH
PNVLAPSVSSTPSHGNSGGYTTGGTSDLSDSQRKNFTFKIVMTKRNLLLCAPSEEDEIKWLGAVRALIARRAGSG
QQQQPIPAATGMARAESSGGVKSPTKRLSVGTAMVAGGGGKSTPSPDEEVRDGHGH*
Coding >AgabiH97|080740
ATGTCGCCCTCGGCAGCCCCGCCAACTCCTCTAGAAGTACAGCGTAAACTCTCTGTGCATTCAGCAACACATCCC
ATCAAGGTATCACCTTCGATGCCCTTCTTGAATACAACTGTTTCCGGTACAGAATCCGATTCTGATTCCATTTTA
ACTCCGGATGTGGGCATATCGTCATCACATACTCCTGGTGGTGCTGCCGTCAGCCATACTATACCTCCACCCTTG
TCTTCTATAGCTGAACAGTCCCCTGGAAGTGGGGCTGAAGATTCGGATGAAGAGGAAGAAGAAGGGGGTTGGCAA
ATGGGTGAAGATGTTGCGGCAAAAACTCCCCGTGGGGTTGATACGACTATCAAGTCTGGTTATCTAGCAAAGAAA
GGTGCTCGACGAAAGACATGGAAGAAACGTTGGTTCGTTCTTCGGCCTTCCCACTTGGCGTTTTACAAAACCGAA
GCGGAATACAAACTTTTGAGACTTTTGGATCTTGCAGATGTGCATTCATGTACACCTGTTCATCTGAAACGGCAT
GATAACGCTTTCGGACTTATACTTCCGAAACGAACATATTATTTACAAGCGGGATCGGCTAAGGATGCGCAGGCA
TGGGTAGAGGCTATTGAAGAAGCAAGAGTTACATTGATGACGACCTCTACTCAAACTTCTACCAATTCTAATGCT
ATACCGATACCTGGGGCTGCGAGGACGTCTTTCTTTCACGGTTCAGTACCGATATCGAGTTCCCCTCAGAATATG
GATCATGTCAATTCGTCGGATTCGGAAGATGCATTGTCTGTGGGTGCTCCTTCTCCGCCGTCTCCACCACCACCA
CCTCCGCCGATGGTTTCTTCTTCGCCTGGGGTTGAAGGTCAACGTGGTAATATGCAGAATGTGACGTTTAGTGTT
TCTCCGTCAAAGCCTTCACCTCCGGTGATTTTGTCGGGATATCTCATGAAATGCGGGTCGAAGAGGAGGAATTGG
CGGAAACGGTGGTTTGTGTTGAGTTCTGATAAATTGATCTATTCGCGGAGTCATATGGATATAAAACCGCATCGA
ATGTTTACATTGAATGATATATTGGACGCGATGGATTATGATATGCCGGTTCATCGACATCATCATCATCATCAT
CCTAATGTTTTGGCCCCTTCTGTTTCGTCGACGCCATCTCATGGGAATAGTGGGGGGTATACGACGGGGGGGACA
TCTGATTTGTCGGATTCGCAACGAAAAAACTTTACATTCAAGATTGTGATGACGAAACGGAATTTGTTGCTGTGT
GCGCCGAGTGAAGAGGATGAAATCAAGTGGTTGGGAGCGGTGAGAGCATTGATTGCTAGAAGGGCTGGTTCGGGT
CAGCAGCAACAACCAATACCGGCGGCGACGGGGATGGCTAGGGCTGAAAGTAGTGGAGGGGTGAAGAGTCCGACG
AAGCGGTTGAGTGTGGGTACTGCGATGGTGGCGGGGGGTGGTGGAAAGTCGACACCGTCGCCGGATGAGGAGGTG
CGGGATGGACATGGACACTAG
Transcript >AgabiH97|080740
ATGTCGCCCTCGGCAGCCCCGCCAACTCCTCTAGAAGTACAGCGTAAACTCTCTGTGCATTCAGCAACACATCCC
ATCAAGGTATCACCTTCGATGCCCTTCTTGAATACAACTGTTTCCGGTACAGAATCCGATTCTGATTCCATTTTA
ACTCCGGATGTGGGCATATCGTCATCACATACTCCTGGTGGTGCTGCCGTCAGCCATACTATACCTCCACCCTTG
TCTTCTATAGCTGAACAGTCCCCTGGAAGTGGGGCTGAAGATTCGGATGAAGAGGAAGAAGAAGGGGGTTGGCAA
ATGGGTGAAGATGTTGCGGCAAAAACTCCCCGTGGGGTTGATACGACTATCAAGTCTGGTTATCTAGCAAAGAAA
GGTGCTCGACGAAAGACATGGAAGAAACGTTGGTTCGTTCTTCGGCCTTCCCACTTGGCGTTTTACAAAACCGAA
GCGGAATACAAACTTTTGAGACTTTTGGATCTTGCAGATGTGCATTCATGTACACCTGTTCATCTGAAACGGCAT
GATAACGCTTTCGGACTTATACTTCCGAAACGAACATATTATTTACAAGCGGGATCGGCTAAGGATGCGCAGGCA
TGGGTAGAGGCTATTGAAGAAGCAAGAGTTACATTGATGACGACCTCTACTCAAACTTCTACCAATTCTAATGCT
ATACCGATACCTGGGGCTGCGAGGACGTCTTTCTTTCACGGTTCAGTACCGATATCGAGTTCCCCTCAGAATATG
GATCATGTCAATTCGTCGGATTCGGAAGATGCATTGTCTGTGGGTGCTCCTTCTCCGCCGTCTCCACCACCACCA
CCTCCGCCGATGGTTTCTTCTTCGCCTGGGGTTGAAGGTCAACGTGGTAATATGCAGAATGTGACGTTTAGTGTT
TCTCCGTCAAAGCCTTCACCTCCGGTGATTTTGTCGGGATATCTCATGAAATGCGGGTCGAAGAGGAGGAATTGG
CGGAAACGGTGGTTTGTGTTGAGTTCTGATAAATTGATCTATTCGCGGAGTCATATGGATATAAAACCGCATCGA
ATGTTTACATTGAATGATATATTGGACGCGATGGATTATGATATGCCGGTTCATCGACATCATCATCATCATCAT
CCTAATGTTTTGGCCCCTTCTGTTTCGTCGACGCCATCTCATGGGAATAGTGGGGGGTATACGACGGGGGGGACA
TCTGATTTGTCGGATTCGCAACGAAAAAACTTTACATTCAAGATTGTGATGACGAAACGGAATTTGTTGCTGTGT
GCGCCGAGTGAAGAGGATGAAATCAAGTGGTTGGGAGCGGTGAGAGCATTGATTGCTAGAAGGGCTGGTTCGGGT
CAGCAGCAACAACCAATACCGGCGGCGACGGGGATGGCTAGGGCTGAAAGTAGTGGAGGGGTGAAGAGTCCGACG
AAGCGGTTGAGTGTGGGTACTGCGATGGTGGCGGGGGGTGGTGGAAAGTCGACACCGTCGCCGGATGAGGAGGTG
CGGGATGGACATGGACACTAG
Gene >AgabiH97|080740
ATGTCGCCCTCGGCAGCCCCGCCAACTCCTCTAGAAGTACAGCGTAAACTCTCTGTGCATTCAGCAACACATCCC
ATCAAGGTAAAATATCCCACTTTTAGTTTCCTTTTTTACTTAGTCATTCAACACGCACGCCTATACCGCGTGTTT
TCTTTCAACATTTCTTCCCTCAACAAAACAAACATCAACTTCAATCGCTAAAATTTTTGTTTATTTAGGTATCAC
CTTCGATGCCCTTCTTGAATACAACTGTTTCCGGTACAGAATCCGATTCTGATTCCATTTTAACTCCGGATGTGG
GCATATCGTCATCACATACTCCTGGTGGTGCTGCCGTCAGCCATACTATACCTCCACCCTTGTCTTCTATAGCTG
AACAGTCCCCTGGAAGTGGGGCTGAAGATTCGGATGAAGAGGAAGAAGAAGGGGGTTGGCAAATGGGTGAAGATG
TTGCGGCAAAAACTCCCCGTGGGGTTGATACGACTATCAAGTCTGGTTATCTAGCAAAGAAAGGTGCTCGACGAA
AGGTTTGTTTATTTTATCATCCTTTAATTATCTGAGGTTAGCTCAACGCTGTTTAGACATGGAAGAAACGTTGGT
TCGTTCTTCGGCCTTCCCACTTGGCGTTTTACAAAACCGAAGCGGAATACAAACTTTTGAGACTTTTGGATCTTG
CAGATGTGCATTCATGTACACCTGTTCATCTGAAACGGCATGATAACGCTTTCGGACTTATACTTCCGAAACGAA
CATATTATTTACAAGCGGGATCGGCTAAGGATGCGCAGGCATGGGTAGAGGCTATTGAAGAAGCAAGAGTTACAT
TGATGACGACCTCTACTCAAACTTCTACCAATTCTAATGCTATACCGATACCTGGGGCTGCGAGGACGTCTTTCT
TTCACGGTTCAGTACCGATATCGAGTTCCCCTCAGAATATGGATCATGTCAATTCGTCGGATTCGGAAGATGCAT
TGTCTGTGGGTGCTCCTTCTCCGCCGTCTCCACCACCACCACCTCCGCCGATGGTTTCTTCTTCGCCTGGGGTTG
AAGGTCAACGTGGTAATATGCAGAATGTGACGTTTAGTGTTTCTCCGTCAAAGCCTTCACCTCCGGTGATTTTGT
CGGGATATCTCATGAAATGCGGGTCGAAGAGGAGGAATTGGCGGAAACGGTGGTTTGTGTTGAGTTCTGATAAAT
TGATCTATTCGCGGAGTCATATGGTGAGTTTTTTTTTTCAAGGTGTGTAGAGAGAGGATGGAGTGCTGACGGAGC
GCCAGGATATAAAACCGCATCGAATGTTTACATTGAATGATATATTGGACGCGATGGATTATGATATGCCGGTTC
ATCGACATCATCATCATCATCATCCTAATGTTTTGGCCCCTTCTGTTTCGTCGACGCCATCTCATGGGAATAGTG
GGGGGTATACGACGGGGGGGACATCTGATTTGTCGGATTCGCAACGAAAAAACTTTACATTCAAGATTGTGATGA
CGAAACGGAATTTGTTGCTGTGTGCGCCGAGTGAAGAGGATGAAATCAAGTGGTTGGGAGCGGTGAGAGCATTGA
TTGCTAGAAGGGCTGGTTCGGGTCAGCAGCAACAACCAATACCGGCGGCGACGGGGATGGCTAGGGCTGAAAGTA
GTGGAGGGGTGAAGAGTCCGACGAAGCGGTTGAGTGTGGGTACTGCGATGGTGGCGGGGGGTGGTGGAAAGTCGA
CACCGTCGCCGGATGAGGAGGTGCGGGATGGACATGGACACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail