Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080690
Gene name
Locationscaffold_5:669697..671173
Strand-
Gene length (bp)1476
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.9E-44 32 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 24 373 6.0E-64
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 29 366 7.0E-64
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 28 369 9.0E-64
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 28 369 1.0E-63
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 24 373 4.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1 24 373 6.0E-64
sp|O74544|GTR2_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr2 PE=3 SV=1 29 366 7.0E-64
sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens GN=RRAGC PE=1 SV=1 28 369 9.0E-64
sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=1 SV=1 28 369 1.0E-63
sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2 24 373 4.0E-63
sp|P53290|GTR2_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTR2 PE=1 SV=1 30 366 9.0E-53
sp|Q54IK1|RRAGA_DICDI Ras-related GTP-binding protein A OS=Dictyostelium discoideum GN=ragA PE=2 SV=1 30 296 3.0E-12
sp|Q63486|RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus GN=Rraga PE=1 SV=1 30 301 1.0E-07
sp|Q80X95|RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus GN=Rraga PE=1 SV=1 30 301 1.0E-07
sp|Q7L523|RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens GN=RRAGA PE=1 SV=1 30 301 1.0E-07
sp|Q3SX43|RRAGA_BOVIN Ras-related GTP-binding protein A OS=Bos taurus GN=RRAGA PE=2 SV=1 30 301 1.0E-07
sp|O74824|GTR1_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtr1 PE=3 SV=1 30 274 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080690
MTSHVSYNAISRPARPVMHGSRRSSQATPRTKVLFLGLHRAGKSSIHHVLFKDLPPKQTFYLETTMRIMKYPIDT
VIPLEIWDSPGNATPESIGIPIGQFRSLIFVIDIRDLYNQPITKLMDFVTAAYQSNPNINIEVFVHKSEKLPEDD
KVENFRQIQERVTDRLLDHDYEGVQPNFYLTSVYDHSLREAFSRVLHKLIDSLPYLEDMLNVFCANSQSPKAFLY
DTKSRLYIATDASPVDSAAHHLCCDYLEMLTSFGSLYKSAASATSSRHTQLASPENPTDSSALSAIGRSDPRTPT
GQPTKAMFYPSAATSLHASTPGTTLTFHGITSSLALLALVPTAVYEGRRGLLEYNVVFFREGVQEICDVETEVRE
GG*
Coding >AgabiH97|080690
ATGACCAGCCATGTCTCCTACAACGCTATCTCCCGCCCGGCCCGGCCTGTCATGCATGGCTCGCGTCGCTCGTCC
CAGGCCACTCCGCGCACAAAGGTCCTCTTTCTCGGTCTCCACAGGGCCGGAAAGTCCTCGATTCACCATGTCTTG
TTCAAGGACCTGCCACCCAAGCAGACTTTCTACCTCGAGACAACCATGCGCATTATGAAGTATCCAATAGATACA
GTCATTCCCCTTGAAATATGGGATTCACCAGGGAATGCGACTCCAGAATCCATAGGCATTCCAATAGGTCAATTC
CGCAGTCTGATCTTCGTCATCGACATACGGGATCTGTACAACCAACCCATCACCAAACTCATGGACTTTGTGACA
GCGGCTTATCAATCCAATCCCAATATCAACATAGAGGTCTTTGTACACAAGTCCGAAAAGCTACCCGAAGACGAC
AAAGTCGAAAATTTTAGACAAATACAGGAACGGGTAACGGATCGGCTACTGGACCATGACTACGAAGGAGTGCAA
CCCAATTTCTATCTGACCTCGGTCTATGACCATTCCCTCCGCGAAGCATTTTCTCGCGTGCTTCACAAGCTGATT
GACTCCCTTCCCTACCTAGAAGACATGCTAAACGTATTTTGTGCTAATTCCCAATCACCCAAGGCCTTCCTATAT
GACACCAAGTCTCGACTATATATTGCGACGGATGCTTCCCCCGTGGACAGTGCTGCACATCACTTGTGTTGTGAC
TATCTTGAGATGCTGACTTCGTTCGGCAGTCTTTACAAGTCGGCGGCATCAGCCACCTCTTCGCGCCATACGCAG
TTGGCGTCTCCTGAAAACCCCACAGATTCTTCGGCTTTATCAGCCATTGGTCGTTCGGATCCGAGAACCCCAACC
GGACAACCGACAAAAGCCATGTTTTACCCCAGTGCGGCGACATCATTACACGCTTCGACTCCAGGGACGACGCTT
ACCTTCCACGGGATTACGTCGTCGCTTGCGCTGCTTGCCCTTGTGCCGACTGCTGTTTACGAGGGCAGGCGGGGG
TTGCTAGAGTATAACGTCGTGTTTTTCAGAGAAGGTGTACAAGAAATATGTGATGTAGAAACGGAAGTTCGGGAA
GGTGGATGA
Transcript >AgabiH97|080690
ATGACCAGCCATGTCTCCTACAACGCTATCTCCCGCCCGGCCCGGCCTGTCATGCATGGCTCGCGTCGCTCGTCC
CAGGCCACTCCGCGCACAAAGGTCCTCTTTCTCGGTCTCCACAGGGCCGGAAAGTCCTCGATTCACCATGTCTTG
TTCAAGGACCTGCCACCCAAGCAGACTTTCTACCTCGAGACAACCATGCGCATTATGAAGTATCCAATAGATACA
GTCATTCCCCTTGAAATATGGGATTCACCAGGGAATGCGACTCCAGAATCCATAGGCATTCCAATAGGTCAATTC
CGCAGTCTGATCTTCGTCATCGACATACGGGATCTGTACAACCAACCCATCACCAAACTCATGGACTTTGTGACA
GCGGCTTATCAATCCAATCCCAATATCAACATAGAGGTCTTTGTACACAAGTCCGAAAAGCTACCCGAAGACGAC
AAAGTCGAAAATTTTAGACAAATACAGGAACGGGTAACGGATCGGCTACTGGACCATGACTACGAAGGAGTGCAA
CCCAATTTCTATCTGACCTCGGTCTATGACCATTCCCTCCGCGAAGCATTTTCTCGCGTGCTTCACAAGCTGATT
GACTCCCTTCCCTACCTAGAAGACATGCTAAACGTATTTTGTGCTAATTCCCAATCACCCAAGGCCTTCCTATAT
GACACCAAGTCTCGACTATATATTGCGACGGATGCTTCCCCCGTGGACAGTGCTGCACATCACTTGTGTTGTGAC
TATCTTGAGATGCTGACTTCGTTCGGCAGTCTTTACAAGTCGGCGGCATCAGCCACCTCTTCGCGCCATACGCAG
TTGGCGTCTCCTGAAAACCCCACAGATTCTTCGGCTTTATCAGCCATTGGTCGTTCGGATCCGAGAACCCCAACC
GGACAACCGACAAAAGCCATGTTTTACCCCAGTGCGGCGACATCATTACACGCTTCGACTCCAGGGACGACGCTT
ACCTTCCACGGGATTACGTCGTCGCTTGCGCTGCTTGCCCTTGTGCCGACTGCTGTTTACGAGGGCAGGCGGGGG
TTGCTAGAGTATAACGTCGTGTTTTTCAGAGAAGGTGTACAAGAAATATGTGATGTAGAAACGGAAGTTCGGGAA
GGTGGATGA
Gene >AgabiH97|080690
ATGACCAGCCATGTCTCCTACAACGCTATCTCCCGCCCGGCCCGGCCTGTCATGCATGGCTCGCGTCGCTCGTCC
CAGGCCACTCCGCGCACAAAGGTCCTCTTTCTCGGTCTCCACAGGTCTGCCTCCTCTTTGCTTCGGCGACCCCCC
TTGGCCAATATCTTCTCTGCTCTAGGGCCGGAAAGTCCTCGATTCACCATGTCTTGTTCAAGGACCTGCCACCCA
AGCAGACTTTCTACCTCGAGACAACCATGCGCATTATGAAGTATCCAATAGAGTGCGAATTTTATGTCTTTTTCG
TACGCGTTTTTGTCACTGATGTTTTGACCGCTCAATTTATCTCCAGTACAGTCATTCCCCTTGAAATATGGGATT
CACCAGGGAATGCGACTCCAGAATCCATAGGCATTCCAATAGGTCAATTCCGCAGTCTGATCTTCGTCATCGACA
TACGGGTATGTTTGAGTCACTCGAGTGGCTACATCTCTATGACCACGCGTGCAGGATCTGTACAACCAACCCATC
ACCAAACTCATGGACTTTGTGACAGCGGCTTATCAATCCAATCCCAATATCAACATAGAGGTCTTTGTACACAAG
TCCGAAAAGCTACCCGAAGACGACAAAGTCGGTACGTTCTTTTTTTGGAAGTCCTATTCTCAGCGTGACTCACGT
TGTCTTCTTAGAAAATTTTAGACAAATACAGGAACGGGTAACGGATCGGCTACTGGACCATGACTACGAAGGAGT
GCAACCCAATTTCTATCTGACCTCGGTCTATGACCATTCCCTCCGCGAAGCATTTTCTCGCGTGCTTCACAAGCT
GATTGACTCCCTTCCCTACCTAGAAGACATGCTAAACGTATTTTGTGCTGTACGTTTGACCTTTTGATTGCGTCC
AAATTTACAGCTTACCGACATGAAATTAGAATTCCCAATCACCCAAGGCCTTCCTATATGACACCAAGTCTCGAC
TATATATTGCGACGGATGCTTCCCCCGTGGACAGTGCTGCACATCACTTGTGTTGTGACTATCTTGAGATGCTGA
CTTCGTTCGGCAGTCTTTACAAGTAAAGATGCTGTCTTCATCAATTCATGGTTTTGATGGCTGATATGTCGATTT
GTCAGGTCGGCGGCATCAGCCACCTCTTCGCGCCATACGCAGTTGGCGTCTCCTGAAAACCCCACAGATTCTTCG
GCTTTATCAGCCATTGGTCGTTCGGATCCGAGAACCCCAACCGGACAACCGACAAAAGCCATGTTTTACCCCAGT
GCGGCGACATCATTACACGCTTCGACTCCAGGGACGACGCTTACCTTCCACGGGATTACGTCGTCGCTTGCGCTG
CTTGCCCTTGTGCCGACTGCTGTTTACGAGGGCAGGCGGGGGTTGCTAGAGTATAACGTCGTGTTTTTCAGAGAA
GGTGTACAAGAAATATGTGATGTAGAAACGGAAGTTCGGGAAGGTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail