Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080680
Gene name
Locationscaffold_5:656688..669388
Strand-
Gene length (bp)12700
Transcript length (bp)11796
Coding sequence length (bp)11796
Protein length (aa) 3932

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 1.8E-151 733 1086
PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain 8.6E-73 2213 2374
PF00698 Acyl_transf_1 Acyl transferase domain 1.3E-68 1686 2060
PF18314 FAS_I_H Fatty acid synthase type I helical domain 8.1E-65 2402 2602
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 1.1E-46 1143 1289
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 4.9E-32 171 425
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 6.8E-27 15 141
PF01575 MaoC_dehydratas MaoC like domain 2.4E-25 1570 1668
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.2E-24 3226 3437
PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily 4.2E-15 3812 3908
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 6.2E-13 3566 3655
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 5.6E-10 1307 1422
PF00106 adh_short short chain dehydrogenase 1.0E-06 2727 2902

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 2097 3928 0.0E+00
sp|P78615|FAS2_EMEND Fatty acid synthase subunit alpha OS=Emericella nidulans GN=fasA PE=3 SV=1 2081 3926 0.0E+00
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 2081 3926 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 9 2074 0.0E+00
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 6 2084 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 2097 3928 0.0E+00
sp|P78615|FAS2_EMEND Fatty acid synthase subunit alpha OS=Emericella nidulans GN=fasA PE=3 SV=1 2081 3926 0.0E+00
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 2081 3926 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 9 2074 0.0E+00
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 6 2084 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 16 2074 0.0E+00
sp|P43098|FAS2_CANAX Fatty acid synthase subunit alpha OS=Candida albicans GN=FAS2 PE=3 SV=1 2081 3926 0.0E+00
sp|G8BAW7|FAS2_CANPC Fatty acid synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=FAS2 PE=2 SV=1 2081 3926 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 12 2074 0.0E+00
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 2081 3926 0.0E+00
sp|Q765N2|FAS2_LACKL Fatty acid synthase subunit alpha OS=Lachancea kluyveri GN=FAS2 PE=3 SV=1 2081 3926 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 69 2073 0.0E+00
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 156 2075 0.0E+00
sp|Q5B7V0|FAS2_EMENI Fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fasA PE=2 SV=1 2688 3928 0.0E+00
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 2705 3475 0.0E+00
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 3564 3926 6.0E-59
sp|Q5B7V0|FAS2_EMENI Fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fasA PE=2 SV=1 2087 2601 3.0E-58
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 2155 2485 9.0E-29
sp|Q2RGI1|ACPS_MOOTA Holo-[acyl-carrier-protein] synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=acpS PE=3 SV=1 3822 3931 9.0E-16
sp|Q9HU15|FABY_PSEAE Beta-ketoacyl-[acyl-carrier-protein] synthase FabY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabY PE=1 SV=1 3097 3486 3.0E-14
sp|A5US51|ACPS_ROSS1 Holo-[acyl-carrier-protein] synthase OS=Roseiflexus sp. (strain RS-1) GN=acpS PE=3 SV=1 3830 3931 4.0E-14
sp|B1I1U5|ACPS_DESAP Holo-[acyl-carrier-protein] synthase OS=Desulforudis audaxviator (strain MP104C) GN=acpS PE=3 SV=1 3810 3928 4.0E-14
sp|Q2LTJ7|ACPS_SYNAS Holo-[acyl-carrier-protein] synthase OS=Syntrophus aciditrophicus (strain SB) GN=acpS PE=3 SV=1 3829 3922 2.0E-13
sp|A7NPN5|ACPS_ROSCS Holo-[acyl-carrier-protein] synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=acpS PE=3 SV=1 3830 3931 2.0E-12
sp|Q97LR5|ACPS_CLOAB Holo-[acyl-carrier-protein] synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=acpS PE=3 SV=1 3810 3926 3.0E-12
sp|B2A4X6|ACPS_NATTJ Holo-[acyl-carrier-protein] synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=acpS PE=3 SV=1 3810 3926 8.0E-12
sp|B2TQY6|ACPS_CLOBB Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=acpS PE=3 SV=1 3810 3926 3.0E-11
sp|B9M2U0|ACPS_GEODF Holo-[acyl-carrier-protein] synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=acpS PE=3 SV=1 3810 3924 5.0E-11
sp|B2V003|ACPS_CLOBA Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=acpS PE=3 SV=1 3810 3926 7.0E-11
sp|B8I3U1|ACPS_CLOCE Holo-[acyl-carrier-protein] synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=acpS PE=3 SV=1 3830 3929 9.0E-11
sp|Q7UQA5|ACPS_RHOBA Holo-[acyl-carrier-protein] synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acpS PE=3 SV=1 3810 3925 1.0E-10
sp|B5EI15|ACPS_GEOBB Holo-[acyl-carrier-protein] synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=acpS PE=3 SV=1 3810 3924 2.0E-10
sp|Q9Z8M5|ACPS_CHLPN Holo-[acyl-carrier-protein] synthase OS=Chlamydia pneumoniae GN=acpS PE=3 SV=1 3810 3928 2.0E-10
sp|A5N379|ACPS_CLOK5 Holo-[acyl-carrier-protein] synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=acpS PE=3 SV=1 3810 3926 2.0E-10
sp|B0K5Y6|ACPS_THEPX Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter sp. (strain X514) GN=acpS PE=3 SV=1 3815 3928 4.0E-10
sp|B0KD52|ACPS_THEP3 Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=acpS PE=3 SV=1 3815 3928 4.0E-10
sp|B9MKY6|ACPS_CALBD Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=acpS PE=3 SV=1 3830 3928 4.0E-10
sp|Q8R857|ACPS_CALS4 Holo-[acyl-carrier-protein] synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=acpS PE=3 SV=1 3811 3928 6.0E-10
sp|Q39UG1|ACPS_GEOMG Holo-[acyl-carrier-protein] synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=acpS PE=3 SV=1 3810 3924 1.0E-09
sp|Q74C71|ACPS_GEOSL Holo-[acyl-carrier-protein] synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=acpS PE=3 SV=1 3810 3925 1.0E-09
sp|Q254H8|ACPS_CHLFF Holo-[acyl-carrier-protein] synthase OS=Chlamydophila felis (strain Fe/C-56) GN=acpS PE=3 SV=1 3822 3928 1.0E-09
sp|B8D0V9|ACPS_HALOH Holo-[acyl-carrier-protein] synthase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=acpS PE=3 SV=1 3810 3925 2.0E-09
sp|A4XIB7|ACPS_CALS8 Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=acpS PE=3 SV=1 3829 3928 2.0E-09
sp|Q01RT7|ACPS_SOLUE Holo-[acyl-carrier-protein] synthase OS=Solibacter usitatus (strain Ellin6076) GN=acpS PE=3 SV=1 3810 3924 2.0E-09
sp|B8G840|ACPS_CHLAD Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=acpS PE=3 SV=1 3814 3924 2.0E-09
sp|C6E2U2|ACPS_GEOSM Holo-[acyl-carrier-protein] synthase OS=Geobacter sp. (strain M21) GN=acpS PE=3 SV=1 3810 3924 4.0E-09
sp|Q67K77|ACPS_SYMTH Holo-[acyl-carrier-protein] synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=acpS PE=3 SV=1 3810 3924 7.0E-09
sp|A4J8G9|ACPS_DESRM Holo-[acyl-carrier-protein] synthase OS=Desulfotomaculum reducens (strain MI-1) GN=acpS PE=3 SV=1 3812 3928 7.0E-09
sp|Q0TUE3|ACPS_CLOP1 Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=acpS PE=3 SV=1 3810 3926 7.0E-09
sp|A0L8S4|ACPS_MAGMM Holo-[acyl-carrier-protein] synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acpS PE=3 SV=1 3810 3926 9.0E-09
sp|B3E694|ACPS_GEOLS Holo-[acyl-carrier-protein] synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=acpS PE=3 SV=1 3810 3924 1.0E-08
sp|Q6MAG4|ACPS_PARUW Holo-[acyl-carrier-protein] synthase OS=Protochlamydia amoebophila (strain UWE25) GN=acpS PE=3 SV=1 3811 3930 1.0E-08
sp|Q5L623|ACPS_CHLAB Holo-[acyl-carrier-protein] synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=acpS PE=3 SV=1 3822 3928 1.0E-08
sp|Q0SW89|ACPS_CLOPS Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=acpS PE=3 SV=1 3810 3926 2.0E-08
sp|Q3Z9B0|ACPS_DEHM1 Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=acpS PE=3 SV=1 3830 3928 2.0E-08
sp|Q8XNP1|ACPS_CLOPE Holo-[acyl-carrier-protein] synthase OS=Clostridium perfringens (strain 13 / Type A) GN=acpS PE=3 SV=1 3810 3926 2.0E-08
sp|B9LIY4|ACPS_CHLSY Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=acpS PE=3 SV=1 3822 3924 2.0E-08
sp|A9WE63|ACPS_CHLAA Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=acpS PE=3 SV=1 3822 3924 2.0E-08
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 3251 3444 2.0E-08
sp|Q7NE72|ACPS_GLOVI Holo-[acyl-carrier-protein] synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=acpS PE=3 SV=1 3823 3924 3.0E-08
sp|Q3ZZK3|ACPS_DEHMC Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=acpS PE=3 SV=1 3830 3928 3.0E-08
sp|A5FS12|ACPS_DEHMB Holo-[acyl-carrier-protein] synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=acpS PE=3 SV=1 3830 3928 3.0E-08
sp|B0SM94|ACPS_LEPBP Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acpS PE=3 SV=1 3826 3924 3.0E-08
sp|B0SE17|ACPS_LEPBA Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acpS PE=3 SV=1 3826 3924 3.0E-08
sp|Q73LF7|ACPS_TREDE Holo-[acyl-carrier-protein] synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=acpS PE=3 SV=1 3810 3924 3.0E-08
sp|Q820E7|ACPS_CHLCV Holo-[acyl-carrier-protein] synthase OS=Chlamydophila caviae (strain GPIC) GN=acpS PE=3 SV=1 3822 3926 3.0E-08
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 3251 3469 4.0E-08
sp|Q5Z0D8|ACPS_NOCFA Holo-[acyl-carrier-protein] synthase OS=Nocardia farcinica (strain IFM 10152) GN=acpS PE=3 SV=1 3809 3925 5.0E-08
sp|A8M4B5|ACPS_SALAI Holo-[acyl-carrier-protein] synthase OS=Salinispora arenicola (strain CNS-205) GN=acpS PE=3 SV=1 3810 3928 6.0E-08
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 3242 3453 7.0E-08
sp|A6M302|ACPS_CLOB8 Holo-[acyl-carrier-protein] synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=acpS PE=3 SV=1 3810 3926 1.0E-07
sp|A6TVL0|ACPS_ALKMQ Holo-[acyl-carrier-protein] synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=acpS PE=3 SV=1 3827 3929 1.0E-07
sp|Q6AD33|ACPS_LEIXX Holo-[acyl-carrier-protein] synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=acpS PE=3 SV=1 3810 3925 1.0E-07
sp|A4XBI2|ACPS_SALTO Holo-[acyl-carrier-protein] synthase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=acpS PE=3 SV=1 3810 3928 2.0E-07
sp|B3QTH9|ACPS_CHLT3 Holo-[acyl-carrier-protein] synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=acpS PE=3 SV=1 3813 3924 2.0E-07
sp|A4SCZ9|ACPS_CHLPM Holo-[acyl-carrier-protein] synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=acpS PE=3 SV=1 3813 3926 2.0E-07
sp|Q890W8|ACPS_CLOTE Holo-[acyl-carrier-protein] synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=acpS PE=3 SV=1 3827 3926 2.0E-07
sp|A0PY92|ACPS_CLONN Holo-[acyl-carrier-protein] synthase OS=Clostridium novyi (strain NT) GN=acpS PE=3 SV=1 3810 3926 2.0E-07
sp|B3QR46|ACPS_CHLP8 Holo-[acyl-carrier-protein] synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=acpS PE=3 SV=1 3829 3926 2.0E-07
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 3242 3444 3.0E-07
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 3224 3478 3.0E-07
sp|A9B2B6|ACPS_HERA2 Holo-[acyl-carrier-protein] synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=acpS PE=3 SV=1 3830 3925 3.0E-07
sp|Q31HN9|ACPS_THICR Holo-[acyl-carrier-protein] synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=acpS PE=3 SV=1 3810 3930 3.0E-07
sp|Q3A5V3|ACPS_PELCD Holo-[acyl-carrier-protein] synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=acpS PE=3 SV=1 3833 3924 3.0E-07
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 3253 3474 4.0E-07
sp|B5YJG8|ACPS_THEYD Holo-[acyl-carrier-protein] synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=acpS PE=3 SV=1 3810 3925 4.0E-07
sp|A6W5X5|ACPS_KINRD Holo-[acyl-carrier-protein] synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=acpS PE=3 SV=1 3810 3930 5.0E-07
sp|Q8KB56|ACPS_CHLTE Holo-[acyl-carrier-protein] synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acpS PE=3 SV=1 3813 3926 7.0E-07
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 3222 3474 7.0E-07
sp|Q3B672|ACPS_CHLL7 Holo-[acyl-carrier-protein] synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=acpS PE=3 SV=1 3830 3926 8.0E-07
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1681 1747 1.0E-06
sp|Q1JK99|ACPS_STRPC Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=acpS PE=3 SV=1 3810 3918 1.0E-06
sp|Q1JA49|ACPS_STRPB Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=acpS PE=3 SV=1 3810 3918 1.0E-06
sp|Q48RM7|ACPS_STRPM Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=acpS PE=3 SV=1 3810 3918 1.0E-06
sp|A8MJ27|ACPS_ALKOO Holo-[acyl-carrier-protein] synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=acpS PE=3 SV=1 3825 3928 2.0E-06
sp|B5XI22|ACPS_STRPZ Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|P0CZ51|ACPS_STRPQ Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|A2RCT2|ACPS_STRPG Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|Q1J544|ACPS_STRPF Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|Q1JF93|ACPS_STRPD Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|P63474|ACPS_STRP8 Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|Q5XAA3|ACPS_STRP6 Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|P0CZ50|ACPS_STRP3 Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=acpS PE=3 SV=1 3810 3918 2.0E-06
sp|B0BB87|ACPS_CHLTB Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=acpS PE=3 SV=1 3822 3928 3.0E-06
sp|B0B9K8|ACPS_CHLT2 Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=acpS PE=3 SV=1 3822 3928 3.0E-06
sp|Q5FPZ9|ACPS_GLUOX Holo-[acyl-carrier-protein] synthase OS=Gluconobacter oxydans (strain 621H) GN=acpS PE=3 SV=1 3810 3924 3.0E-06
sp|Q03IX7|ACPS_STRTD Holo-[acyl-carrier-protein] synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=acpS PE=3 SV=1 3810 3929 3.0E-06
sp|C3M8S2|ACPS_RHISN Holo-[acyl-carrier-protein] synthase OS=Rhizobium sp. (strain NGR234) GN=acpS PE=3 SV=1 3810 3905 3.0E-06
sp|Q5M2S6|ACPS_STRT2 Holo-[acyl-carrier-protein] synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=acpS PE=3 SV=1 3810 3929 3.0E-06
sp|Q5LY70|ACPS_STRT1 Holo-[acyl-carrier-protein] synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=acpS PE=3 SV=1 3810 3929 3.0E-06
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 3251 3475 3.0E-06
sp|Q6A6U0|ACPS_PROAC Holo-[acyl-carrier-protein] synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=acpS PE=3 SV=2 3810 3924 4.0E-06
sp|O84102|ACPS_CHLTR Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=acpS PE=3 SV=1 3822 3928 4.0E-06
sp|Q3KMS0|ACPS_CHLTA Holo-[acyl-carrier-protein] synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=acpS PE=3 SV=1 3822 3928 4.0E-06
sp|Q99Y97|ACPS_STRP1 Holo-[acyl-carrier-protein] synthase OS=Streptococcus pyogenes serotype M1 GN=acpS PE=3 SV=1 3810 3918 5.0E-06
sp|B3EGP9|ACPS_CHLL2 Holo-[acyl-carrier-protein] synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=acpS PE=3 SV=1 3830 3926 5.0E-06
sp|Q92R49|ACPS_RHIME Holo-[acyl-carrier-protein] synthase OS=Rhizobium meliloti (strain 1021) GN=acpS PE=3 SV=1 3810 3905 6.0E-06
sp|Q1IHY2|ACPS_KORVE Holo-[acyl-carrier-protein] synthase OS=Koribacter versatilis (strain Ellin345) GN=acpS PE=3 SV=1 3810 3924 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0004317 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Yes
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0004312 fatty acid synthase activity No
GO:0016836 hydro-lyase activity No
GO:0005488 binding No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016491 oxidoreductase activity No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0016829 lyase activity No
GO:0003674 molecular_function No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0019171 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080680
MAVPNGHAVPHAIASRPLIVAQGRVRISVPVSTKTDEWIAAEVLRDEFIHAQSLDAADASSVIEDESEATVDLAA
KFLAHVASNIDNDSQSTEARIRLLLNVLKHFTSSYLATKDIHSLCASYSIDTRKTVLSAYYRAVAALENKDSSSI
PRQPESALLDAAKSGKASIFALFGGQGTNEVYFNELQSLYDIYQPYVTPFLESVLPDLIGLAEDEVDSSYYTHGL
DVVSWLSDATKRPSIAYLASAPLSLPLIGLTQLIQYLVVCRVANLTPGQVRSRIAGATGHSQGILSAVVISASET
FDDFTENSRKALRWLFYCGLRGQQAFPPVAVEPSLVQDTLDGGEGTPSPMLSVAGLPLKDLEVHIKKTNSHLPAN
SQLGVSLYNGPRAFVVTGPARALHGLVTNLRKVRAPSGADQSKVPFSQRKPVFSVRFLVVGVPYHSPYLKGVTDA
VMDEDLEELWEPSDLKIPVYNTETGEDMRNMTGSITRSLCDQIYTAPIHWTKATDFPETATHAIDFGPGGLSGVG
PLSARNFDGRGIRVILVGDSGKGDAELYDSLSVKYEDWWSKKFAPSLVRTSDGTIHLDTPMSRLLGKPPIMVAGM
TPTTVKAGFVSAILNAGYHVELAGGGHYNAKDLRAKVAEIQSKLPSGVGLTLNALYINPRQFTFQFPLWQELRRE
GAPVEGFCVAAGVPTTEKANEIIEGLRTAGIKHIAFKPGSVDGLRQVVNIAASNPDFPIICQWTGGRGGGHHSYE
DFHQPILSTYRSLRSHSNIVLVAGSGFGDAEDIWPYLTGDWSERFGVQRMPFDGFLFASRVMVAKEAHTSSSVKD
LIVAAAGVEDEQWEGTYTKPTGGVLTVRSELGEPIHKVANRAVRLWKEFDNTVFSLPKEKRAAWLSERRDEIIEK
LNKDFAKPWFGEKKDGSVAKELGDMTYEETVLRLVRLMYVSKQKRWIDRSLRNLTGDWLRRVEERFAGVNTTGNK
PSLLQSYASLDDPSAFVESFFEAYPLATEQLLAADDVAYFLAISQRPGQKPVPFIPVLDVSFEVWFKKDSLWAAE
DIDAVFDQDPERVAILQGPVSAKGSLVKDEPIKELLGNINSSLISKLLESRYGGDESSIPTIDYLAAEPFVPATL
SNVARYERGSDVVYQFGSSLPSTEDWLAALGGSELNWLHALVTSETIVQGTSYIDNPIRRLLAPRPKQRIVVGYE
NSLPVSITAYGAARSYGAHIPGFKAVEIKFNQSSQLIDITMFEERRDVAVPLKLQFHYQPEQGYMPIHEIVDGRN
QRIKDFYWKLWYGDNEVLPNVDIKEKLVGPEVTITAEEVEEFCAVVGNQGESFKNVRNDSVQAPMDFAIVTGWQA
IMRSIFPADIDGDLLKLVHLSNGFKMVEGASPLKVGDICKSEARIVSVVNAPEGKTVTVKGHVYRDDQPVIEVVS
SFLYRGRFTDYENTFETTEEPDYLVPLETDAEVGVLQSKQWFGWENESTPLLAGTALIFRIQSSVFFKDRGVFRN
VSVSGDVFVRNQLKVLVKVGNVDFQQDDCQGNPVLSYLQRHGTPQGLPTPLANEGYTLRHVEGSTIFNAPLTNEP
YSKISGDFNPIHVNPYFSDYASLPTTITHGMWSSAATRRYVENVVAQGHPDRVLAYNVSFVGMVLPNDELEVKLK
HTCMRDGNIVVAIETTNSRGEKVLVGTAEVKQPTTVYVFTGQGSQEPGMGMDLYNNSPAARAVWDGADAHLLATY
GFSISEIVRDNPKEKTIYFGGIQGQAIRQRYMDMTYDTLDKDGNTKTLPLFADIDNRTPRYTFSHPNGLLFATQF
AQIALVVTEKSAFEDMRAKGFVQKDCAFAGHSLGEYSALASIADVLHISALVDVVFYRGITMQRAVERDSENRSN
YAMCAVNPSRISKTFSDAALREVVDMIAVKTGSLLEIVNFNVEGQQYVCAGELVALQTMTNVLNYLKVKKVDIAQ
LTKQFPIEKVKQMLGDIITECNQRALDQQKSQGYIILERGFATIPLPGIDVPFHSRYLWAGVLPFRAYLSKKINP
ATLNPDMLVGKYIPNLIAKPFAVSREYAQIIYDQTSSPRLDKVLQKWEEDNWDSSENRQMLAYIILVELLAYQFA
SPVRWIQTQDLLFTQYKFERLIELGPSPTLTGMASRTLKAKFESSDDSVSCTRVILCHAKNTKEVYYQYEDEPEA
PAEAAPDAPAPATAVASAAPVAVAAVAVAAAGPAASIEDAPIKAIDILLVIVAQKLKKRVDEVPLSKSIKDLVGG
KSTLQNEILGDLQQEFASAPEKGEELSLEELGSALSTGFSGALGKYTTSLVARLVGGKMPGGFNASAIRSYLNKT
WGLGPSRADGVLLLATTLEPPKRIASEAEAKTWLDGVVQTYAQRSGISLTAPGAAAGAVGGGGGATINSEEFLKF
TADQDKFIQQHIELYNRYLKKDSRAGEIAYDREKVNTLALQAKIDSITREHGDSYLDGIQPRFDPLKARHFDSSW
NWVRQDALLMYYDIIFGRLTTVDRDITARCIALLNRADPDMLQYMEYHINKLDPSKGDTYKLAKDFGQQLIDNTR
DIIGKSPLYKDVTFPTAPHTEVTAKGDIVYSEIVRENVRKLEAYVEEMATGDGVAGSVNIQKVQDDVLKLWTVVK
SLPEINQDQKNRIKSLYEGVVRSLQKGPDPHPRVQSTRSRRSSSQFLRPHNAGVANVTADNIPLLHLKRRVAATW
EYSSNLTGVYLDILHEIATSGTTFEGKNALCTGVGKGSIGVEIVKGLLSGGAHVVITTSSYSRKTVEYYQSIFQT
VGSRGSALTVVPFNQASKQDVEALVDYIYNNLNMDLDYILPFAGIPENGREIDGLDDRSELAHRMMLVNLLRILG
CVKNKKANRRIVTRPTQVILPLSPNHGLFGNDGLYSESKISLETLFQRWASESWGEYLCLAGAVIGWTRGTGLMA
PTNIVAHELEGYGVRTFSAKEMAFNILGLMHPLLFSITQVEPIWADLNGGMDRLPDLADITTRIRTNLLKKADLR
RAITKDNAADFKVTNGVEAERLLQTIDVLPRANFRFDFPELESAESLSDVTQLRGMIDLEKVVVVTGFAEVGPWG
SSRTRWEMEARGELTIEGYIEMAWMMGYIKHFNGRLKDGSLYVGWVDSKSGESVDDKDVKGRYEKDILAHAGIRL
IEPEIFRGYDPNRKSFNQEIELIHDLEPIEVSEVEAQKFKLQHGDKCDIWAGEDGQWFAKLKKGACVLVPKAFKF
SRTVAGQIPSGWHAGRYGIPEDIIAQTDRCTLWALVCTAEALNSAGITDPYELYKYMHPSEVGTSLGSGMGGATS
MAKMFKDRRDEREVQNDILQETFINTTAGWVNLLLMSSSGPVKIPVGACATALQSLEIACDTILSGKAKVMIAGG
FDDISEEGSYEFANMKATSNAETEFAMGREPTEMSRPATTSRAGFMEAQGTGVHIVMSAKTALEIGAPIRGILAF
TSTSTDKAGRSVPAPGKGALSVAREVPSKHPLQILDVKYRSRQLAFRRTQISQWLDHEHVELQEEITSRKSEGEN
VDESYVASRVANLEKEAARQEKDAIAMYGMLEGSDPRVAPLRRALAVWGLNADDIGVLSIHGTSTGANEKNETQI
WNDIFTTISRSRGNAVPIVAQKSLLGHSKGGSAAWQMAGLLQYVLSGVIPGNRNSDNIDSNFVDRRFLMFPSKTI
YTDGIQAGVMSSFGFGQVGGTALVVHPRYLFGALEPSFYEQYKERNRTRALQSYKAMSDMMVKNSLVKIKENPPF
TPENEREVLMNSMARVTCDPKTGEYSFKGKLPREAPLDLSNLKLVSDVMTAPSAATNSNIIGVGVDQELITSVPS
HNPTFVARNFTEAEIAYCRAQPSPASSFAARWVGKEAVFKSLGVKSAGAAAVLKDIEILNDDAGVPSVRLHGEAQ
VKAQERGVANVLISLSHSETIAIAFAQASST*
Coding >AgabiH97|080680
ATGGCGGTTCCCAACGGCCATGCCGTCCCCCATGCCATCGCTTCCCGCCCCCTCATCGTCGCCCAAGGCCGAGTT
CGAATCTCTGTCCCCGTCTCTACAAAAACCGATGAATGGATCGCCGCAGAAGTTCTGCGTGACGAGTTTATCCAT
GCACAATCCCTGGATGCCGCAGACGCGTCGTCTGTGATCGAGGACGAATCTGAAGCCACAGTAGATCTGGCCGCA
AAATTTCTTGCACACGTTGCATCTAATATCGATAACGACTCGCAATCAACCGAAGCACGCATACGTCTACTTTTG
AATGTGCTCAAACACTTTACGTCTTCATACCTTGCCACTAAGGATATCCATTCTCTGTGCGCATCATACTCCATC
GACACTCGCAAGACCGTCCTTTCGGCATACTATCGCGCTGTCGCAGCTCTCGAGAACAAGGACAGCAGTTCCATC
CCCCGCCAACCCGAGTCTGCTTTATTGGATGCTGCCAAATCTGGCAAGGCCTCGATCTTTGCCCTTTTCGGGGGA
CAAGGGACCAACGAGGTTTACTTCAATGAATTGCAATCACTCTATGATATATACCAACCGTATGTTACCCCGTTC
CTGGAATCCGTCCTCCCTGATCTTATCGGGCTCGCCGAGGATGAAGTCGATAGCTCCTACTATACCCACGGATTA
GATGTTGTTTCTTGGCTCTCGGATGCCACTAAGCGGCCTTCCATCGCTTACCTCGCGTCGGCTCCCCTTTCACTG
CCACTCATTGGGCTCACCCAGCTCATCCAGTATCTCGTCGTTTGCCGCGTCGCCAACCTCACACCTGGCCAAGTT
CGTAGCCGTATTGCCGGTGCCACTGGCCACTCTCAGGGCATTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACT
TTCGATGACTTCACCGAGAATTCGCGCAAGGCCCTTCGTTGGCTTTTCTACTGTGGTCTTCGTGGCCAACAAGCA
TTCCCTCCTGTCGCCGTTGAACCCAGCCTCGTCCAGGACACCTTGGATGGGGGAGAAGGTACTCCATCACCCATG
TTGTCTGTCGCCGGTCTTCCCCTCAAGGATCTTGAGGTTCATATCAAGAAGACCAACTCCCACCTCCCTGCCAAC
TCTCAGCTCGGCGTCTCTTTATACAACGGGCCTCGTGCATTCGTCGTGACTGGGCCGGCTCGCGCCTTACATGGT
CTAGTGACCAACCTTCGAAAGGTCAGGGCGCCCAGTGGCGCTGACCAGAGCAAAGTTCCTTTTTCGCAGCGCAAG
CCCGTCTTCTCTGTCCGTTTCTTGGTCGTTGGCGTTCCTTATCACAGTCCGTACCTCAAGGGCGTGACTGACGCC
GTCATGGACGAGGATTTGGAAGAACTGTGGGAGCCCTCTGATTTGAAGATCCCTGTATATAATACGGAAACCGGT
GAAGATATGCGCAACATGACCGGCTCGATTACACGCTCCTTATGCGATCAGATCTACACAGCACCAATCCATTGG
ACCAAGGCTACTGATTTCCCTGAGACCGCCACCCACGCTATTGATTTCGGTCCCGGTGGTCTCAGTGGAGTGGGT
CCTTTATCTGCAAGAAATTTCGATGGTCGCGGTATTCGTGTAATTCTCGTCGGCGACAGTGGCAAAGGAGATGCT
GAGTTGTACGATTCTTTGAGCGTCAAATACGAGGATTGGTGGAGTAAGAAGTTCGCGCCTAGTTTGGTCCGAACA
AGTGACGGCACTATCCATCTCGACACCCCTATGTCCCGTCTGCTTGGCAAACCACCTATCATGGTTGCCGGTATG
ACTCCAACGACCGTCAAGGCCGGTTTCGTCAGCGCCATCCTCAATGCCGGATATCATGTTGAACTGGCTGGTGGT
GGCCACTATAATGCCAAAGACCTACGTGCTAAGGTCGCTGAAATCCAATCCAAGCTACCGTCCGGCGTCGGTCTC
ACCCTGAACGCCCTTTACATCAATCCCCGCCAGTTCACCTTCCAATTCCCCTTGTGGCAAGAACTCCGTAGAGAG
GGAGCGCCCGTCGAAGGGTTCTGTGTTGCCGCAGGTGTTCCCACCACCGAAAAGGCTAACGAGATCATTGAGGGT
TTGAGGACTGCAGGTATCAAGCATATTGCGTTCAAGCCGGGTTCAGTTGACGGCCTTCGCCAAGTGGTCAATATT
GCCGCTTCGAATCCCGATTTCCCTATCATTTGTCAATGGACCGGTGGTCGTGGTGGTGGTCACCACTCATACGAA
GATTTCCATCAGCCGATCCTTTCCACCTACCGCTCCCTTCGTAGCCACTCAAATATCGTTCTTGTTGCTGGATCT
GGTTTCGGCGACGCTGAAGACATTTGGCCGTATCTGACCGGAGACTGGTCAGAGCGTTTCGGTGTTCAGCGGATG
CCATTCGACGGGTTTTTGTTCGCCAGCCGTGTCATGGTTGCGAAAGAGGCGCATACATCATCTTCGGTTAAGGAT
TTGATTGTTGCCGCTGCTGGTGTCGAGGACGAGCAATGGGAGGGCACATATACTAAGCCCACTGGCGGCGTTTTG
ACCGTCCGTTCCGAGTTAGGCGAACCCATTCATAAAGTTGCGAATCGTGCAGTGAGGTTGTGGAAGGAGTTTGAC
AACACTGTCTTCAGTCTTCCGAAGGAGAAGCGTGCTGCGTGGTTGAGTGAGCGTCGTGACGAAATTATCGAGAAG
TTGAATAAGGATTTTGCCAAGCCGTGGTTTGGAGAGAAGAAGGATGGTAGTGTCGCCAAGGAATTGGGTGACATG
ACTTATGAGGAGACAGTTTTGCGCCTGGTCAGGTTGATGTATGTCTCGAAACAAAAGCGCTGGATCGACAGGTCC
CTCCGGAACTTGACTGGTGATTGGCTGAGGCGCGTCGAAGAGCGCTTTGCTGGTGTGAACACTACTGGCAATAAG
CCTTCACTCCTTCAATCTTATGCTTCTCTCGATGATCCCTCAGCCTTCGTCGAATCGTTTTTCGAGGCATATCCT
CTTGCCACTGAACAACTGCTCGCCGCCGACGATGTGGCATATTTCCTCGCTATTTCCCAGCGACCCGGTCAGAAG
CCAGTTCCCTTCATCCCCGTCTTAGATGTGTCTTTTGAAGTTTGGTTTAAGAAGGACTCCCTCTGGGCTGCTGAA
GATATCGACGCTGTATTTGATCAAGATCCCGAGCGTGTTGCTATCCTTCAAGGTCCCGTTTCGGCGAAAGGTTCT
CTTGTCAAGGATGAGCCCATCAAGGAGCTGCTCGGCAACATCAATTCCTCTCTCATCTCCAAATTGCTCGAATCG
CGTTATGGTGGTGATGAATCTTCTATTCCGACCATTGATTATCTCGCGGCGGAGCCATTCGTCCCTGCAACACTT
TCCAACGTCGCTCGCTATGAGAGGGGTTCAGACGTCGTTTATCAATTTGGTTCTTCTCTTCCTTCTACTGAAGAC
TGGCTCGCTGCCCTCGGCGGTTCGGAACTCAACTGGCTTCACGCCCTCGTCACTTCGGAGACCATAGTCCAGGGC
ACTTCTTATATCGATAACCCTATCCGCCGTCTTCTTGCTCCACGCCCCAAACAACGCATCGTCGTTGGTTACGAG
AATTCCTTACCTGTTTCTATCACTGCTTACGGTGCCGCTCGATCTTATGGTGCCCACATCCCTGGCTTCAAGGCT
GTCGAGATTAAGTTCAACCAGTCTTCTCAACTCATCGACATCACTATGTTCGAAGAACGTCGGGATGTTGCCGTG
CCCCTCAAACTTCAATTCCATTATCAACCCGAGCAGGGCTACATGCCCATACACGAGATTGTTGACGGCCGTAAC
CAGCGCATCAAAGACTTTTATTGGAAGTTGTGGTATGGTGACAATGAGGTGTTACCAAACGTCGACATCAAGGAG
AAATTGGTTGGCCCCGAGGTCACTATTACGGCGGAGGAAGTGGAGGAGTTCTGTGCTGTGGTTGGGAATCAAGGA
GAGTCATTTAAGAATGTGAGGAATGATAGTGTGCAAGCGCCTATGGATTTCGCTATTGTTACAGGCTGGCAGGCT
ATCATGCGCTCGATTTTCCCCGCTGACATCGACGGTGACCTGCTCAAGTTGGTTCATCTTTCTAATGGCTTCAAG
ATGGTTGAAGGCGCATCTCCTCTCAAAGTTGGTGATATTTGCAAATCGGAAGCTCGGATCGTCTCCGTCGTCAAT
GCTCCGGAGGGCAAGACGGTTACGGTTAAAGGGCACGTCTACCGGGACGATCAGCCCGTCATCGAAGTGGTCTCT
TCTTTCTTATATCGCGGTCGATTCACTGATTACGAGAACACATTCGAGACCACGGAGGAGCCTGACTATCTTGTC
CCCCTTGAAACTGATGCAGAAGTCGGTGTTCTGCAATCGAAGCAGTGGTTTGGCTGGGAGAACGAATCGACTCCT
CTCCTTGCCGGGACTGCTCTCATCTTCCGCATTCAATCATCCGTGTTTTTCAAAGATCGTGGTGTTTTCCGTAAC
GTTTCTGTTTCTGGTGATGTTTTCGTGCGCAATCAGCTCAAAGTACTCGTCAAAGTTGGCAACGTCGACTTCCAG
CAAGATGATTGCCAAGGCAATCCCGTCCTCTCCTATCTGCAACGTCACGGTACTCCTCAAGGCCTCCCCACCCCT
CTTGCGAACGAGGGTTACACTCTTCGACACGTCGAAGGTTCTACGATTTTCAACGCTCCTCTTACTAATGAGCCT
TATTCTAAGATTTCTGGTGACTTCAACCCTATCCATGTTAACCCCTACTTTTCCGATTATGCTTCCCTTCCTACT
ACGATTACTCATGGCATGTGGTCGAGTGCTGCCACTCGTCGCTACGTCGAAAATGTCGTCGCTCAAGGCCATCCC
GACCGTGTCCTCGCTTACAACGTCTCGTTCGTCGGCATGGTTCTACCCAATGACGAGCTCGAGGTGAAACTCAAG
CATACTTGCATGCGGGATGGTAACATCGTCGTCGCCATCGAAACCACTAATTCTCGCGGCGAGAAGGTCCTCGTT
GGCACTGCCGAAGTTAAGCAGCCAACAACCGTCTACGTCTTCACTGGCCAGGGTTCTCAAGAGCCTGGTATGGGC
ATGGACCTTTACAACAACTCTCCTGCTGCTCGTGCTGTCTGGGATGGTGCCGACGCTCATTTGCTCGCTACTTAC
GGTTTCTCTATCAGCGAAATCGTGAGGGATAATCCCAAGGAGAAGACAATTTACTTCGGTGGTATTCAAGGTCAA
GCTATCCGTCAACGTTACATGGACATGACCTATGATACGCTTGACAAAGACGGCAACACAAAAACTCTTCCTCTT
TTTGCTGACATTGATAATCGTACTCCCCGTTATACCTTCAGCCATCCCAATGGTCTCCTATTTGCTACCCAATTT
GCTCAGATCGCTCTCGTCGTTACAGAGAAGTCGGCGTTTGAAGACATGCGTGCGAAGGGCTTTGTTCAAAAGGAC
TGCGCCTTCGCTGGTCATTCGTTGGGTGAATACTCCGCTCTCGCTTCCATCGCCGACGTTCTCCATATCTCTGCC
CTCGTCGATGTTGTCTTCTACCGTGGTATTACCATGCAGCGTGCTGTTGAACGAGACTCTGAGAATCGCTCGAAC
TATGCCATGTGTGCTGTTAACCCGTCTCGAATTTCCAAGACTTTTAGTGATGCTGCTTTGCGCGAAGTTGTTGAT
ATGATCGCGGTCAAGACTGGATCGCTACTTGAAATCGTCAACTTCAACGTGGAGGGTCAACAATACGTCTGCGCC
GGAGAGCTGGTTGCCCTTCAAACGATGACTAACGTTTTGAATTACCTCAAGGTGAAGAAGGTTGATATCGCTCAG
TTGACCAAGCAATTCCCGATCGAGAAGGTCAAGCAGATGTTGGGTGATATCATCACCGAGTGCAATCAACGAGCT
CTTGATCAGCAGAAGAGCCAGGGCTATATTATCCTTGAACGTGGCTTTGCTACTATCCCCTTGCCTGGTATTGAT
GTGCCGTTCCATTCCCGTTATCTATGGGCAGGTGTTCTACCCTTCCGAGCTTATCTTTCCAAGAAAATTAACCCT
GCAACTCTCAACCCCGACATGCTCGTCGGGAAATACATTCCGAATCTTATCGCTAAACCCTTTGCTGTCTCCCGC
GAGTACGCTCAAATCATCTACGATCAAACCTCATCCCCTCGTCTCGATAAAGTCCTCCAGAAATGGGAGGAGGAC
AATTGGGACAGCTCCGAAAACCGACAAATGCTCGCGTACATCATACTCGTTGAACTTCTCGCATACCAATTTGCT
TCCCCCGTCCGATGGATCCAAACTCAGGATCTCCTTTTCACTCAGTATAAGTTCGAACGCCTCATTGAGTTGGGC
CCGTCACCCACACTTACCGGTATGGCTTCTCGTACGTTGAAGGCCAAATTTGAATCGTCGGACGACTCTGTTTCG
TGTACTCGTGTCATTCTTTGCCATGCGAAGAACACCAAAGAGGTCTACTATCAATACGAGGATGAGCCTGAAGCC
CCTGCCGAGGCTGCACCCGACGCTCCCGCCCCCGCTACTGCTGTCGCTTCAGCTGCTCCTGTCGCTGTGGCCGCT
GTTGCTGTGGCCGCTGCCGGACCCGCTGCCAGCATCGAAGACGCACCGATCAAAGCTATCGATATTCTCCTTGTC
ATCGTCGCCCAGAAGTTGAAGAAACGTGTTGATGAAGTTCCTCTTTCTAAATCTATCAAAGACCTCGTCGGAGGC
AAGTCGACTCTCCAGAACGAAATTCTCGGGGATTTACAACAAGAATTCGCGTCTGCGCCTGAGAAAGGAGAGGAA
TTATCGCTTGAGGAATTGGGGTCTGCTTTGAGTACTGGTTTCAGTGGCGCCCTTGGCAAGTACACAACGAGCCTT
GTCGCTCGTCTAGTTGGTGGAAAGATGCCCGGTGGATTCAATGCTTCTGCTATTCGTTCGTACTTGAACAAGACA
TGGGGCCTTGGACCTTCTCGCGCTGATGGTGTTCTCCTTCTTGCTACCACTCTTGAGCCCCCCAAGCGTATCGCC
TCCGAGGCTGAGGCAAAGACTTGGCTCGATGGCGTTGTTCAAACCTATGCTCAGCGATCAGGTATCTCTTTGACT
GCCCCTGGGGCCGCTGCTGGCGCTGTCGGTGGAGGTGGAGGTGCCACAATCAACAGCGAGGAATTCCTCAAGTTT
ACGGCGGATCAAGACAAGTTCATCCAGCAACATATCGAGCTTTATAACCGCTACCTGAAAAAGGACTCGCGAGCT
GGAGAGATTGCCTACGATCGCGAGAAGGTTAACACCCTTGCTCTTCAGGCGAAGATTGACAGCATTACTCGTGAA
CATGGTGATTCTTACCTCGACGGTATTCAGCCCCGCTTCGATCCTTTGAAAGCCCGTCATTTCGATTCGTCCTGG
AATTGGGTTCGTCAAGATGCTCTTCTCATGTATTACGATATCATCTTTGGCCGCCTTACCACTGTTGATCGTGAC
ATTACTGCTCGTTGCATTGCTCTCCTCAATCGTGCCGACCCTGACATGCTCCAATATATGGAGTATCACATCAAT
AAGCTTGACCCCTCGAAGGGCGACACCTACAAGTTGGCCAAGGACTTTGGTCAACAATTGATCGACAATACTCGC
GACATCATTGGCAAATCTCCTCTTTACAAAGACGTCACCTTCCCTACCGCCCCCCACACTGAAGTCACTGCCAAG
GGTGACATTGTATATTCTGAAATTGTCCGTGAAAATGTTCGCAAGCTCGAAGCTTACGTCGAAGAAATGGCAACC
GGTGACGGCGTTGCCGGATCTGTCAACATCCAGAAAGTTCAAGATGATGTCTTGAAGCTCTGGACCGTCGTCAAG
TCGCTTCCTGAAATCAATCAGGACCAGAAGAACAGGATCAAATCGTTGTACGAGGGCGTTGTTCGCTCTCTCCAG
AAAGGTCCAGATCCCCATCCCCGCGTGCAGAGTACTCGCAGTCGTCGCTCCTCTTCTCAATTCCTCCGTCCTCAC
AATGCCGGTGTCGCAAATGTCACAGCCGACAATATCCCTCTGCTCCATCTCAAACGTCGCGTCGCTGCCACATGG
GAGTACAGTAGTAACCTCACTGGTGTCTACCTCGATATCCTTCATGAGATTGCCACGTCAGGTACTACGTTTGAG
GGCAAGAATGCTCTCTGCACTGGTGTCGGCAAGGGCTCCATTGGCGTTGAGATCGTCAAAGGTCTTCTTTCTGGT
GGTGCTCACGTTGTAATCACAACTTCTAGCTACAGTCGCAAGACCGTCGAGTACTACCAATCCATTTTCCAAACC
GTCGGAAGCCGTGGGTCAGCACTTACCGTTGTGCCCTTCAATCAGGCCTCAAAACAAGACGTCGAGGCTCTCGTG
GATTACATTTATAACAACCTCAATATGGATCTCGATTACATCCTTCCTTTCGCTGGTATTCCTGAAAACGGCCGT
GAGATTGATGGACTTGATGACCGCTCTGAACTCGCTCACCGCATGATGCTGGTCAACTTACTTCGCATCCTCGGT
TGCGTCAAGAATAAGAAGGCTAATAGGCGTATCGTCACCCGCCCCACTCAAGTTATACTCCCTCTGTCGCCTAAT
CATGGCCTCTTCGGTAATGATGGCCTGTATTCCGAATCCAAGATCTCTCTTGAGACTCTATTCCAACGATGGGCC
TCGGAAAGTTGGGGTGAATATTTATGCTTGGCAGGTGCTGTCATTGGATGGACTCGTGGCACTGGCCTTATGGCT
CCTACCAATATAGTTGCTCATGAGCTCGAGGGATATGGCGTCAGGACCTTCTCTGCTAAGGAAATGGCATTCAAC
ATCCTCGGTTTGATGCATCCCTTGCTCTTTAGTATCACTCAAGTTGAGCCTATCTGGGCGGATCTCAACGGTGGC
ATGGATCGTCTGCCAGACCTGGCCGATATCACGACTCGTATCCGCACGAACTTACTCAAGAAGGCCGATCTTAGA
CGCGCCATTACCAAGGATAATGCTGCAGACTTCAAGGTCACAAATGGTGTTGAAGCTGAACGCCTTCTTCAAACC
ATTGACGTCCTTCCTCGAGCCAACTTCCGTTTCGATTTCCCCGAACTTGAATCCGCCGAATCTTTGTCTGATGTT
ACTCAACTGCGCGGTATGATTGATCTTGAGAAGGTTGTGGTTGTCACCGGGTTCGCCGAGGTAGGCCCTTGGGGT
AGTTCTCGTACACGTTGGGAGATGGAAGCTCGTGGAGAGTTAACAATTGAAGGATACATCGAGATGGCTTGGATG
ATGGGTTACATCAAACATTTCAACGGTCGTCTCAAAGATGGTTCGCTGTACGTTGGATGGGTTGATAGCAAGAGC
GGTGAATCCGTAGATGATAAAGATGTTAAGGGACGCTACGAGAAGGACATTCTTGCGCATGCTGGTATCCGTCTG
ATTGAACCCGAAATATTCCGTGGTTATGATCCCAACCGGAAGTCCTTCAACCAGGAAATCGAGCTCATACACGAC
CTTGAGCCAATTGAGGTCTCAGAAGTAGAGGCACAGAAATTCAAGCTCCAGCATGGAGACAAGTGTGATATTTGG
GCTGGTGAAGATGGTCAATGGTTTGCCAAGTTGAAGAAAGGTGCATGTGTTCTCGTCCCGAAAGCTTTCAAGTTC
AGCCGTACTGTCGCTGGACAAATTCCTAGTGGTTGGCATGCTGGACGATACGGTATCCCCGAAGATATCATTGCC
CAGACCGATCGCTGCACTCTATGGGCGTTGGTGTGCACAGCCGAGGCTCTCAATAGTGCTGGTATCACCGACCCC
TATGAGCTCTACAAGTACATGCATCCTTCTGAAGTTGGTACCTCGCTTGGTTCCGGTATGGGTGGTGCCACGAGT
ATGGCCAAGATGTTCAAAGATCGTCGTGATGAACGTGAGGTGCAAAACGATATCCTGCAAGAGACTTTCATTAAC
ACTACCGCTGGCTGGGTTAACTTGCTCTTGATGTCTTCCAGTGGACCCGTGAAGATTCCCGTAGGTGCTTGTGCG
ACGGCTCTTCAATCTCTTGAGATTGCTTGCGATACTATTCTTTCTGGCAAAGCTAAAGTCATGATTGCCGGAGGT
TTCGATGACATCAGTGAGGAGGGTTCGTATGAGTTCGCTAACATGAAGGCTACCAGTAATGCGGAGACCGAATTC
GCCATGGGACGAGAACCTACTGAAATGTCCCGGCCTGCTACCACTTCACGTGCAGGGTTTATGGAGGCTCAAGGT
ACTGGTGTCCATATAGTCATGAGTGCCAAGACCGCCCTCGAAATTGGCGCGCCCATCCGAGGTATACTTGCTTTC
ACTTCCACATCCACTGACAAAGCTGGTCGATCAGTACCAGCTCCTGGAAAGGGTGCTCTGAGTGTTGCCCGAGAA
GTTCCATCTAAACATCCCTTGCAAATCCTCGATGTCAAATATCGCTCGCGCCAGTTGGCATTCCGCCGCACTCAA
ATTTCTCAATGGCTGGATCATGAGCACGTCGAGCTTCAAGAAGAAATAACGTCACGCAAATCGGAAGGAGAGAAC
GTTGATGAAAGTTACGTCGCTTCGCGCGTAGCTAACCTGGAGAAAGAGGCTGCTCGTCAAGAGAAGGACGCTATT
GCTATGTATGGCATGCTTGAGGGATCAGATCCTCGCGTTGCTCCCTTACGTCGTGCTCTTGCTGTCTGGGGTTTG
AATGCTGACGACATCGGCGTCCTTTCTATCCATGGCACCAGTACCGGGGCTAACGAAAAGAACGAGACGCAAATC
TGGAACGACATCTTCACTACTATCTCCCGTAGTCGCGGAAATGCTGTTCCCATCGTCGCTCAGAAGAGCCTCCTT
GGTCACTCTAAGGGTGGGTCCGCTGCTTGGCAGATGGCTGGTCTCTTGCAGTATGTTCTTTCCGGCGTCATCCCA
GGGAACCGCAATAGCGACAACATCGACTCCAATTTCGTTGATCGCCGATTCCTTATGTTCCCCTCTAAAACAATC
TACACCGATGGTATCCAAGCTGGTGTTATGTCTTCCTTTGGTTTCGGTCAAGTTGGTGGAACAGCCCTCGTCGTA
CATCCTCGCTACCTCTTCGGTGCTCTCGAACCGAGTTTCTACGAGCAATACAAGGAAAGAAACCGTACTCGTGCA
CTCCAGTCCTACAAGGCCATGAGTGACATGATGGTCAAAAACTCGCTCGTGAAGATCAAGGAAAACCCACCATTC
ACACCCGAAAACGAACGAGAAGTACTCATGAACTCGATGGCGCGCGTCACTTGTGATCCCAAGACTGGCGAATAT
TCTTTCAAGGGCAAGCTTCCTAGAGAGGCGCCCCTCGATCTATCAAATCTCAAACTTGTATCTGACGTCATGACC
GCTCCCTCTGCCGCTACGAACAGCAATATCATTGGCGTTGGTGTTGACCAAGAGCTTATCACATCTGTTCCCTCC
CACAATCCCACATTTGTTGCTCGCAACTTCACTGAGGCGGAAATAGCTTACTGTCGCGCTCAACCTTCGCCTGCA
TCCTCATTCGCGGCTCGCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCTTGGCGTCAAGTCGGCAGGAGCTGCG
GCTGTTCTGAAAGATATTGAGATTCTCAATGATGATGCCGGTGTTCCCTCTGTTCGTCTCCATGGCGAGGCACAA
GTCAAAGCGCAGGAGCGGGGAGTTGCCAACGTGTTAATTTCTTTGAGTCATTCTGAGACTATCGCCATTGCTTTT
GCACAAGCCTCATCAACTTGA
Transcript >AgabiH97|080680
ATGGCGGTTCCCAACGGCCATGCCGTCCCCCATGCCATCGCTTCCCGCCCCCTCATCGTCGCCCAAGGCCGAGTT
CGAATCTCTGTCCCCGTCTCTACAAAAACCGATGAATGGATCGCCGCAGAAGTTCTGCGTGACGAGTTTATCCAT
GCACAATCCCTGGATGCCGCAGACGCGTCGTCTGTGATCGAGGACGAATCTGAAGCCACAGTAGATCTGGCCGCA
AAATTTCTTGCACACGTTGCATCTAATATCGATAACGACTCGCAATCAACCGAAGCACGCATACGTCTACTTTTG
AATGTGCTCAAACACTTTACGTCTTCATACCTTGCCACTAAGGATATCCATTCTCTGTGCGCATCATACTCCATC
GACACTCGCAAGACCGTCCTTTCGGCATACTATCGCGCTGTCGCAGCTCTCGAGAACAAGGACAGCAGTTCCATC
CCCCGCCAACCCGAGTCTGCTTTATTGGATGCTGCCAAATCTGGCAAGGCCTCGATCTTTGCCCTTTTCGGGGGA
CAAGGGACCAACGAGGTTTACTTCAATGAATTGCAATCACTCTATGATATATACCAACCGTATGTTACCCCGTTC
CTGGAATCCGTCCTCCCTGATCTTATCGGGCTCGCCGAGGATGAAGTCGATAGCTCCTACTATACCCACGGATTA
GATGTTGTTTCTTGGCTCTCGGATGCCACTAAGCGGCCTTCCATCGCTTACCTCGCGTCGGCTCCCCTTTCACTG
CCACTCATTGGGCTCACCCAGCTCATCCAGTATCTCGTCGTTTGCCGCGTCGCCAACCTCACACCTGGCCAAGTT
CGTAGCCGTATTGCCGGTGCCACTGGCCACTCTCAGGGCATTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACT
TTCGATGACTTCACCGAGAATTCGCGCAAGGCCCTTCGTTGGCTTTTCTACTGTGGTCTTCGTGGCCAACAAGCA
TTCCCTCCTGTCGCCGTTGAACCCAGCCTCGTCCAGGACACCTTGGATGGGGGAGAAGGTACTCCATCACCCATG
TTGTCTGTCGCCGGTCTTCCCCTCAAGGATCTTGAGGTTCATATCAAGAAGACCAACTCCCACCTCCCTGCCAAC
TCTCAGCTCGGCGTCTCTTTATACAACGGGCCTCGTGCATTCGTCGTGACTGGGCCGGCTCGCGCCTTACATGGT
CTAGTGACCAACCTTCGAAAGGTCAGGGCGCCCAGTGGCGCTGACCAGAGCAAAGTTCCTTTTTCGCAGCGCAAG
CCCGTCTTCTCTGTCCGTTTCTTGGTCGTTGGCGTTCCTTATCACAGTCCGTACCTCAAGGGCGTGACTGACGCC
GTCATGGACGAGGATTTGGAAGAACTGTGGGAGCCCTCTGATTTGAAGATCCCTGTATATAATACGGAAACCGGT
GAAGATATGCGCAACATGACCGGCTCGATTACACGCTCCTTATGCGATCAGATCTACACAGCACCAATCCATTGG
ACCAAGGCTACTGATTTCCCTGAGACCGCCACCCACGCTATTGATTTCGGTCCCGGTGGTCTCAGTGGAGTGGGT
CCTTTATCTGCAAGAAATTTCGATGGTCGCGGTATTCGTGTAATTCTCGTCGGCGACAGTGGCAAAGGAGATGCT
GAGTTGTACGATTCTTTGAGCGTCAAATACGAGGATTGGTGGAGTAAGAAGTTCGCGCCTAGTTTGGTCCGAACA
AGTGACGGCACTATCCATCTCGACACCCCTATGTCCCGTCTGCTTGGCAAACCACCTATCATGGTTGCCGGTATG
ACTCCAACGACCGTCAAGGCCGGTTTCGTCAGCGCCATCCTCAATGCCGGATATCATGTTGAACTGGCTGGTGGT
GGCCACTATAATGCCAAAGACCTACGTGCTAAGGTCGCTGAAATCCAATCCAAGCTACCGTCCGGCGTCGGTCTC
ACCCTGAACGCCCTTTACATCAATCCCCGCCAGTTCACCTTCCAATTCCCCTTGTGGCAAGAACTCCGTAGAGAG
GGAGCGCCCGTCGAAGGGTTCTGTGTTGCCGCAGGTGTTCCCACCACCGAAAAGGCTAACGAGATCATTGAGGGT
TTGAGGACTGCAGGTATCAAGCATATTGCGTTCAAGCCGGGTTCAGTTGACGGCCTTCGCCAAGTGGTCAATATT
GCCGCTTCGAATCCCGATTTCCCTATCATTTGTCAATGGACCGGTGGTCGTGGTGGTGGTCACCACTCATACGAA
GATTTCCATCAGCCGATCCTTTCCACCTACCGCTCCCTTCGTAGCCACTCAAATATCGTTCTTGTTGCTGGATCT
GGTTTCGGCGACGCTGAAGACATTTGGCCGTATCTGACCGGAGACTGGTCAGAGCGTTTCGGTGTTCAGCGGATG
CCATTCGACGGGTTTTTGTTCGCCAGCCGTGTCATGGTTGCGAAAGAGGCGCATACATCATCTTCGGTTAAGGAT
TTGATTGTTGCCGCTGCTGGTGTCGAGGACGAGCAATGGGAGGGCACATATACTAAGCCCACTGGCGGCGTTTTG
ACCGTCCGTTCCGAGTTAGGCGAACCCATTCATAAAGTTGCGAATCGTGCAGTGAGGTTGTGGAAGGAGTTTGAC
AACACTGTCTTCAGTCTTCCGAAGGAGAAGCGTGCTGCGTGGTTGAGTGAGCGTCGTGACGAAATTATCGAGAAG
TTGAATAAGGATTTTGCCAAGCCGTGGTTTGGAGAGAAGAAGGATGGTAGTGTCGCCAAGGAATTGGGTGACATG
ACTTATGAGGAGACAGTTTTGCGCCTGGTCAGGTTGATGTATGTCTCGAAACAAAAGCGCTGGATCGACAGGTCC
CTCCGGAACTTGACTGGTGATTGGCTGAGGCGCGTCGAAGAGCGCTTTGCTGGTGTGAACACTACTGGCAATAAG
CCTTCACTCCTTCAATCTTATGCTTCTCTCGATGATCCCTCAGCCTTCGTCGAATCGTTTTTCGAGGCATATCCT
CTTGCCACTGAACAACTGCTCGCCGCCGACGATGTGGCATATTTCCTCGCTATTTCCCAGCGACCCGGTCAGAAG
CCAGTTCCCTTCATCCCCGTCTTAGATGTGTCTTTTGAAGTTTGGTTTAAGAAGGACTCCCTCTGGGCTGCTGAA
GATATCGACGCTGTATTTGATCAAGATCCCGAGCGTGTTGCTATCCTTCAAGGTCCCGTTTCGGCGAAAGGTTCT
CTTGTCAAGGATGAGCCCATCAAGGAGCTGCTCGGCAACATCAATTCCTCTCTCATCTCCAAATTGCTCGAATCG
CGTTATGGTGGTGATGAATCTTCTATTCCGACCATTGATTATCTCGCGGCGGAGCCATTCGTCCCTGCAACACTT
TCCAACGTCGCTCGCTATGAGAGGGGTTCAGACGTCGTTTATCAATTTGGTTCTTCTCTTCCTTCTACTGAAGAC
TGGCTCGCTGCCCTCGGCGGTTCGGAACTCAACTGGCTTCACGCCCTCGTCACTTCGGAGACCATAGTCCAGGGC
ACTTCTTATATCGATAACCCTATCCGCCGTCTTCTTGCTCCACGCCCCAAACAACGCATCGTCGTTGGTTACGAG
AATTCCTTACCTGTTTCTATCACTGCTTACGGTGCCGCTCGATCTTATGGTGCCCACATCCCTGGCTTCAAGGCT
GTCGAGATTAAGTTCAACCAGTCTTCTCAACTCATCGACATCACTATGTTCGAAGAACGTCGGGATGTTGCCGTG
CCCCTCAAACTTCAATTCCATTATCAACCCGAGCAGGGCTACATGCCCATACACGAGATTGTTGACGGCCGTAAC
CAGCGCATCAAAGACTTTTATTGGAAGTTGTGGTATGGTGACAATGAGGTGTTACCAAACGTCGACATCAAGGAG
AAATTGGTTGGCCCCGAGGTCACTATTACGGCGGAGGAAGTGGAGGAGTTCTGTGCTGTGGTTGGGAATCAAGGA
GAGTCATTTAAGAATGTGAGGAATGATAGTGTGCAAGCGCCTATGGATTTCGCTATTGTTACAGGCTGGCAGGCT
ATCATGCGCTCGATTTTCCCCGCTGACATCGACGGTGACCTGCTCAAGTTGGTTCATCTTTCTAATGGCTTCAAG
ATGGTTGAAGGCGCATCTCCTCTCAAAGTTGGTGATATTTGCAAATCGGAAGCTCGGATCGTCTCCGTCGTCAAT
GCTCCGGAGGGCAAGACGGTTACGGTTAAAGGGCACGTCTACCGGGACGATCAGCCCGTCATCGAAGTGGTCTCT
TCTTTCTTATATCGCGGTCGATTCACTGATTACGAGAACACATTCGAGACCACGGAGGAGCCTGACTATCTTGTC
CCCCTTGAAACTGATGCAGAAGTCGGTGTTCTGCAATCGAAGCAGTGGTTTGGCTGGGAGAACGAATCGACTCCT
CTCCTTGCCGGGACTGCTCTCATCTTCCGCATTCAATCATCCGTGTTTTTCAAAGATCGTGGTGTTTTCCGTAAC
GTTTCTGTTTCTGGTGATGTTTTCGTGCGCAATCAGCTCAAAGTACTCGTCAAAGTTGGCAACGTCGACTTCCAG
CAAGATGATTGCCAAGGCAATCCCGTCCTCTCCTATCTGCAACGTCACGGTACTCCTCAAGGCCTCCCCACCCCT
CTTGCGAACGAGGGTTACACTCTTCGACACGTCGAAGGTTCTACGATTTTCAACGCTCCTCTTACTAATGAGCCT
TATTCTAAGATTTCTGGTGACTTCAACCCTATCCATGTTAACCCCTACTTTTCCGATTATGCTTCCCTTCCTACT
ACGATTACTCATGGCATGTGGTCGAGTGCTGCCACTCGTCGCTACGTCGAAAATGTCGTCGCTCAAGGCCATCCC
GACCGTGTCCTCGCTTACAACGTCTCGTTCGTCGGCATGGTTCTACCCAATGACGAGCTCGAGGTGAAACTCAAG
CATACTTGCATGCGGGATGGTAACATCGTCGTCGCCATCGAAACCACTAATTCTCGCGGCGAGAAGGTCCTCGTT
GGCACTGCCGAAGTTAAGCAGCCAACAACCGTCTACGTCTTCACTGGCCAGGGTTCTCAAGAGCCTGGTATGGGC
ATGGACCTTTACAACAACTCTCCTGCTGCTCGTGCTGTCTGGGATGGTGCCGACGCTCATTTGCTCGCTACTTAC
GGTTTCTCTATCAGCGAAATCGTGAGGGATAATCCCAAGGAGAAGACAATTTACTTCGGTGGTATTCAAGGTCAA
GCTATCCGTCAACGTTACATGGACATGACCTATGATACGCTTGACAAAGACGGCAACACAAAAACTCTTCCTCTT
TTTGCTGACATTGATAATCGTACTCCCCGTTATACCTTCAGCCATCCCAATGGTCTCCTATTTGCTACCCAATTT
GCTCAGATCGCTCTCGTCGTTACAGAGAAGTCGGCGTTTGAAGACATGCGTGCGAAGGGCTTTGTTCAAAAGGAC
TGCGCCTTCGCTGGTCATTCGTTGGGTGAATACTCCGCTCTCGCTTCCATCGCCGACGTTCTCCATATCTCTGCC
CTCGTCGATGTTGTCTTCTACCGTGGTATTACCATGCAGCGTGCTGTTGAACGAGACTCTGAGAATCGCTCGAAC
TATGCCATGTGTGCTGTTAACCCGTCTCGAATTTCCAAGACTTTTAGTGATGCTGCTTTGCGCGAAGTTGTTGAT
ATGATCGCGGTCAAGACTGGATCGCTACTTGAAATCGTCAACTTCAACGTGGAGGGTCAACAATACGTCTGCGCC
GGAGAGCTGGTTGCCCTTCAAACGATGACTAACGTTTTGAATTACCTCAAGGTGAAGAAGGTTGATATCGCTCAG
TTGACCAAGCAATTCCCGATCGAGAAGGTCAAGCAGATGTTGGGTGATATCATCACCGAGTGCAATCAACGAGCT
CTTGATCAGCAGAAGAGCCAGGGCTATATTATCCTTGAACGTGGCTTTGCTACTATCCCCTTGCCTGGTATTGAT
GTGCCGTTCCATTCCCGTTATCTATGGGCAGGTGTTCTACCCTTCCGAGCTTATCTTTCCAAGAAAATTAACCCT
GCAACTCTCAACCCCGACATGCTCGTCGGGAAATACATTCCGAATCTTATCGCTAAACCCTTTGCTGTCTCCCGC
GAGTACGCTCAAATCATCTACGATCAAACCTCATCCCCTCGTCTCGATAAAGTCCTCCAGAAATGGGAGGAGGAC
AATTGGGACAGCTCCGAAAACCGACAAATGCTCGCGTACATCATACTCGTTGAACTTCTCGCATACCAATTTGCT
TCCCCCGTCCGATGGATCCAAACTCAGGATCTCCTTTTCACTCAGTATAAGTTCGAACGCCTCATTGAGTTGGGC
CCGTCACCCACACTTACCGGTATGGCTTCTCGTACGTTGAAGGCCAAATTTGAATCGTCGGACGACTCTGTTTCG
TGTACTCGTGTCATTCTTTGCCATGCGAAGAACACCAAAGAGGTCTACTATCAATACGAGGATGAGCCTGAAGCC
CCTGCCGAGGCTGCACCCGACGCTCCCGCCCCCGCTACTGCTGTCGCTTCAGCTGCTCCTGTCGCTGTGGCCGCT
GTTGCTGTGGCCGCTGCCGGACCCGCTGCCAGCATCGAAGACGCACCGATCAAAGCTATCGATATTCTCCTTGTC
ATCGTCGCCCAGAAGTTGAAGAAACGTGTTGATGAAGTTCCTCTTTCTAAATCTATCAAAGACCTCGTCGGAGGC
AAGTCGACTCTCCAGAACGAAATTCTCGGGGATTTACAACAAGAATTCGCGTCTGCGCCTGAGAAAGGAGAGGAA
TTATCGCTTGAGGAATTGGGGTCTGCTTTGAGTACTGGTTTCAGTGGCGCCCTTGGCAAGTACACAACGAGCCTT
GTCGCTCGTCTAGTTGGTGGAAAGATGCCCGGTGGATTCAATGCTTCTGCTATTCGTTCGTACTTGAACAAGACA
TGGGGCCTTGGACCTTCTCGCGCTGATGGTGTTCTCCTTCTTGCTACCACTCTTGAGCCCCCCAAGCGTATCGCC
TCCGAGGCTGAGGCAAAGACTTGGCTCGATGGCGTTGTTCAAACCTATGCTCAGCGATCAGGTATCTCTTTGACT
GCCCCTGGGGCCGCTGCTGGCGCTGTCGGTGGAGGTGGAGGTGCCACAATCAACAGCGAGGAATTCCTCAAGTTT
ACGGCGGATCAAGACAAGTTCATCCAGCAACATATCGAGCTTTATAACCGCTACCTGAAAAAGGACTCGCGAGCT
GGAGAGATTGCCTACGATCGCGAGAAGGTTAACACCCTTGCTCTTCAGGCGAAGATTGACAGCATTACTCGTGAA
CATGGTGATTCTTACCTCGACGGTATTCAGCCCCGCTTCGATCCTTTGAAAGCCCGTCATTTCGATTCGTCCTGG
AATTGGGTTCGTCAAGATGCTCTTCTCATGTATTACGATATCATCTTTGGCCGCCTTACCACTGTTGATCGTGAC
ATTACTGCTCGTTGCATTGCTCTCCTCAATCGTGCCGACCCTGACATGCTCCAATATATGGAGTATCACATCAAT
AAGCTTGACCCCTCGAAGGGCGACACCTACAAGTTGGCCAAGGACTTTGGTCAACAATTGATCGACAATACTCGC
GACATCATTGGCAAATCTCCTCTTTACAAAGACGTCACCTTCCCTACCGCCCCCCACACTGAAGTCACTGCCAAG
GGTGACATTGTATATTCTGAAATTGTCCGTGAAAATGTTCGCAAGCTCGAAGCTTACGTCGAAGAAATGGCAACC
GGTGACGGCGTTGCCGGATCTGTCAACATCCAGAAAGTTCAAGATGATGTCTTGAAGCTCTGGACCGTCGTCAAG
TCGCTTCCTGAAATCAATCAGGACCAGAAGAACAGGATCAAATCGTTGTACGAGGGCGTTGTTCGCTCTCTCCAG
AAAGGTCCAGATCCCCATCCCCGCGTGCAGAGTACTCGCAGTCGTCGCTCCTCTTCTCAATTCCTCCGTCCTCAC
AATGCCGGTGTCGCAAATGTCACAGCCGACAATATCCCTCTGCTCCATCTCAAACGTCGCGTCGCTGCCACATGG
GAGTACAGTAGTAACCTCACTGGTGTCTACCTCGATATCCTTCATGAGATTGCCACGTCAGGTACTACGTTTGAG
GGCAAGAATGCTCTCTGCACTGGTGTCGGCAAGGGCTCCATTGGCGTTGAGATCGTCAAAGGTCTTCTTTCTGGT
GGTGCTCACGTTGTAATCACAACTTCTAGCTACAGTCGCAAGACCGTCGAGTACTACCAATCCATTTTCCAAACC
GTCGGAAGCCGTGGGTCAGCACTTACCGTTGTGCCCTTCAATCAGGCCTCAAAACAAGACGTCGAGGCTCTCGTG
GATTACATTTATAACAACCTCAATATGGATCTCGATTACATCCTTCCTTTCGCTGGTATTCCTGAAAACGGCCGT
GAGATTGATGGACTTGATGACCGCTCTGAACTCGCTCACCGCATGATGCTGGTCAACTTACTTCGCATCCTCGGT
TGCGTCAAGAATAAGAAGGCTAATAGGCGTATCGTCACCCGCCCCACTCAAGTTATACTCCCTCTGTCGCCTAAT
CATGGCCTCTTCGGTAATGATGGCCTGTATTCCGAATCCAAGATCTCTCTTGAGACTCTATTCCAACGATGGGCC
TCGGAAAGTTGGGGTGAATATTTATGCTTGGCAGGTGCTGTCATTGGATGGACTCGTGGCACTGGCCTTATGGCT
CCTACCAATATAGTTGCTCATGAGCTCGAGGGATATGGCGTCAGGACCTTCTCTGCTAAGGAAATGGCATTCAAC
ATCCTCGGTTTGATGCATCCCTTGCTCTTTAGTATCACTCAAGTTGAGCCTATCTGGGCGGATCTCAACGGTGGC
ATGGATCGTCTGCCAGACCTGGCCGATATCACGACTCGTATCCGCACGAACTTACTCAAGAAGGCCGATCTTAGA
CGCGCCATTACCAAGGATAATGCTGCAGACTTCAAGGTCACAAATGGTGTTGAAGCTGAACGCCTTCTTCAAACC
ATTGACGTCCTTCCTCGAGCCAACTTCCGTTTCGATTTCCCCGAACTTGAATCCGCCGAATCTTTGTCTGATGTT
ACTCAACTGCGCGGTATGATTGATCTTGAGAAGGTTGTGGTTGTCACCGGGTTCGCCGAGGTAGGCCCTTGGGGT
AGTTCTCGTACACGTTGGGAGATGGAAGCTCGTGGAGAGTTAACAATTGAAGGATACATCGAGATGGCTTGGATG
ATGGGTTACATCAAACATTTCAACGGTCGTCTCAAAGATGGTTCGCTGTACGTTGGATGGGTTGATAGCAAGAGC
GGTGAATCCGTAGATGATAAAGATGTTAAGGGACGCTACGAGAAGGACATTCTTGCGCATGCTGGTATCCGTCTG
ATTGAACCCGAAATATTCCGTGGTTATGATCCCAACCGGAAGTCCTTCAACCAGGAAATCGAGCTCATACACGAC
CTTGAGCCAATTGAGGTCTCAGAAGTAGAGGCACAGAAATTCAAGCTCCAGCATGGAGACAAGTGTGATATTTGG
GCTGGTGAAGATGGTCAATGGTTTGCCAAGTTGAAGAAAGGTGCATGTGTTCTCGTCCCGAAAGCTTTCAAGTTC
AGCCGTACTGTCGCTGGACAAATTCCTAGTGGTTGGCATGCTGGACGATACGGTATCCCCGAAGATATCATTGCC
CAGACCGATCGCTGCACTCTATGGGCGTTGGTGTGCACAGCCGAGGCTCTCAATAGTGCTGGTATCACCGACCCC
TATGAGCTCTACAAGTACATGCATCCTTCTGAAGTTGGTACCTCGCTTGGTTCCGGTATGGGTGGTGCCACGAGT
ATGGCCAAGATGTTCAAAGATCGTCGTGATGAACGTGAGGTGCAAAACGATATCCTGCAAGAGACTTTCATTAAC
ACTACCGCTGGCTGGGTTAACTTGCTCTTGATGTCTTCCAGTGGACCCGTGAAGATTCCCGTAGGTGCTTGTGCG
ACGGCTCTTCAATCTCTTGAGATTGCTTGCGATACTATTCTTTCTGGCAAAGCTAAAGTCATGATTGCCGGAGGT
TTCGATGACATCAGTGAGGAGGGTTCGTATGAGTTCGCTAACATGAAGGCTACCAGTAATGCGGAGACCGAATTC
GCCATGGGACGAGAACCTACTGAAATGTCCCGGCCTGCTACCACTTCACGTGCAGGGTTTATGGAGGCTCAAGGT
ACTGGTGTCCATATAGTCATGAGTGCCAAGACCGCCCTCGAAATTGGCGCGCCCATCCGAGGTATACTTGCTTTC
ACTTCCACATCCACTGACAAAGCTGGTCGATCAGTACCAGCTCCTGGAAAGGGTGCTCTGAGTGTTGCCCGAGAA
GTTCCATCTAAACATCCCTTGCAAATCCTCGATGTCAAATATCGCTCGCGCCAGTTGGCATTCCGCCGCACTCAA
ATTTCTCAATGGCTGGATCATGAGCACGTCGAGCTTCAAGAAGAAATAACGTCACGCAAATCGGAAGGAGAGAAC
GTTGATGAAAGTTACGTCGCTTCGCGCGTAGCTAACCTGGAGAAAGAGGCTGCTCGTCAAGAGAAGGACGCTATT
GCTATGTATGGCATGCTTGAGGGATCAGATCCTCGCGTTGCTCCCTTACGTCGTGCTCTTGCTGTCTGGGGTTTG
AATGCTGACGACATCGGCGTCCTTTCTATCCATGGCACCAGTACCGGGGCTAACGAAAAGAACGAGACGCAAATC
TGGAACGACATCTTCACTACTATCTCCCGTAGTCGCGGAAATGCTGTTCCCATCGTCGCTCAGAAGAGCCTCCTT
GGTCACTCTAAGGGTGGGTCCGCTGCTTGGCAGATGGCTGGTCTCTTGCAGTATGTTCTTTCCGGCGTCATCCCA
GGGAACCGCAATAGCGACAACATCGACTCCAATTTCGTTGATCGCCGATTCCTTATGTTCCCCTCTAAAACAATC
TACACCGATGGTATCCAAGCTGGTGTTATGTCTTCCTTTGGTTTCGGTCAAGTTGGTGGAACAGCCCTCGTCGTA
CATCCTCGCTACCTCTTCGGTGCTCTCGAACCGAGTTTCTACGAGCAATACAAGGAAAGAAACCGTACTCGTGCA
CTCCAGTCCTACAAGGCCATGAGTGACATGATGGTCAAAAACTCGCTCGTGAAGATCAAGGAAAACCCACCATTC
ACACCCGAAAACGAACGAGAAGTACTCATGAACTCGATGGCGCGCGTCACTTGTGATCCCAAGACTGGCGAATAT
TCTTTCAAGGGCAAGCTTCCTAGAGAGGCGCCCCTCGATCTATCAAATCTCAAACTTGTATCTGACGTCATGACC
GCTCCCTCTGCCGCTACGAACAGCAATATCATTGGCGTTGGTGTTGACCAAGAGCTTATCACATCTGTTCCCTCC
CACAATCCCACATTTGTTGCTCGCAACTTCACTGAGGCGGAAATAGCTTACTGTCGCGCTCAACCTTCGCCTGCA
TCCTCATTCGCGGCTCGCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCTTGGCGTCAAGTCGGCAGGAGCTGCG
GCTGTTCTGAAAGATATTGAGATTCTCAATGATGATGCCGGTGTTCCCTCTGTTCGTCTCCATGGCGAGGCACAA
GTCAAAGCGCAGGAGCGGGGAGTTGCCAACGTGTTAATTTCTTTGAGTCATTCTGAGACTATCGCCATTGCTTTT
GCACAAGCCTCATCAACTTGA
Gene >AgabiH97|080680
ATGGCGGTTCCCAACGGCCATGCCGTCCCCCATGCCATCGCTTCCCGCCCCCTCATCGTCGCCCAAGGCCGAGTT
CGAGTTCGTCTTTACTTTTTCTTTGATTTGGTGCCACTGCTGATGCTCGGAATCAGATCTCTGTCCCCGTCTCTA
CAAAAACCGATGAATGGATCGCCGCAGAAGTTCTGCGTGACGAGTTTATCCATGCACAATCCCTGGATGCCGCAG
ACGCGTCGTCTGTGATCGAGGACGAATCTGAAGCCACAGTAGATCTGGCCGCAAAATTTCTTGCACACGTTGCAT
CTAATATCGATAACGACTCGCAATCAACCGAAGCACGCATACGTCTACTTTTGAATGTGCTCAAACACTTTACGT
CTTCATACCTTGCCACTAAGGATATCCATTCTCTGTGCGCATCATACTCCATCGACACTCGCAAGACCGTCCTTT
CGGCATACTATCGCGCTGTCGCAGCTCTCGAGAACAAGGACAGCAGTTCCATCCCCCGCCAACCCGAGTCTGCTT
TATTGGATGCTGCCAAATCTGGCAAGGCCTCGATCTTTGCCCTTTTCGGGGGACAAGGGACCAACGAGGTTTACT
TCAATGAATTGCAATCACTCTATGATATATACCAACCGTATGTTACCCCGTTCCTGGAATCCGTCCTCCCTGATC
TTATCGGGCTCGCCGAGGATGAAGTCGATAGCTCCTACTATACCCACGGATTAGATGTTGTTTCTTGGCTCTCGG
ATGCCACTAAGCGGCCTTCCATCGCTTACCTCGCGTCGGCTCCCCTTTCACTGCCACTCATTGGGCTCACCCAGC
TCATCCAGTATCTCGTCGTTTGCCGCGTCGCCAACCTCACACCTGGCCAAGTTCGTAGCCGTATTGCCGGTGCCA
CTGGCCACTCTCAGGGCATTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACTTTCGATGACTTCACCGAGAATT
CGCGCAAGGCCCTTCGTTGGCTTTTCTACTGTGGTCTTCGTGGCCAACAAGCATTCCCTCCTGTCGCCGTTGAAC
CCAGCCTCGTCCAGGACACCTTGGATGGGGGAGAAGGTACTCCATCACCCATGTTGTCTGTCGCCGGTCTTCCCC
TCAAGGATCTTGAGGTTCATATCAAGAAGACCAACTCCCACCTCCCTGCCAACTCTCAGCTCGGCGTCTCTTTAT
ACAACGGGCCTCGTGCATTCGTCGTGACTGGGCCGGCTCGCGCCTTACATGGTCTAGTGACCAACCTTCGAAAGG
TCAGGGCGCCCAGTGGCGCTGACCAGAGCAAAGTTCCTTTTTCGCAGCGCAAGCCCGTCTTCTCTGTCCGTTTCT
TGGTCGTTGGCGTTCCTTATCACAGTCCGTACCTCAAGGGCGTGACTGACGCCGTCATGGACGAGGATTTGGAAG
AACTGTGGGAGCCCTCTGATTTGAAGATCCCTGTATATAATACGGAAACCGGTATGTTGATTAATTATGTGACGC
GGATCAGGGTTGTAATAATGAATTCAAACGATTAGGTGAAGATATGCGCAACATGACCGGCTCGATTACACGCTC
CTTATGCGATCAGATCTACACAGCACCAATCCATTGGACCAAGGCTACTGATTTCCCTGAGACCGCCACCCACGC
TATTGATTTCGGTCCCGGTGGTCTCAGTGGAGTGGGTCCTTTATCTGCAAGAAATTTCGATGGTCGCGGTATTCG
TGTAATTCTCGTCGGCGACAGTGGCAAAGGAGATGCTGAGTTGTACGATTCTTTGAGCGTCAAATACGAGGATTG
GTGGAGTAAGAAGTTCGCGCCTAGTTTGGTCCGAACAAGGTATGTCGATGCTTCTTCCTCTACACAAGGATTATA
CTCATCTCTTTCAGTGACGGCACTATCCATCTCGACACCCCTATGTCCCGTCTGCTTGGCAAACCACCTATCATG
GTTGCCGGTATGACTCCAACGACCGTCAAGGCCGGTTTCGTCAGCGCCATCCTCAATGCCGGATATCATGTTGAA
CTGGCTGGTGGTGGCCACTATAATGCCAAAGACCTACGTGCTAAGGTCGCTGAAATCCAATCCAAGCTACCGTCC
GGCGTCGGTCTCACCCTGAACGCCCTTTACATCAATCCCCGCCAGTTCACCTTCCAATTCCCCTTGTGGCAAGAA
CTCCGTAGAGAGGGAGCGCCCGTCGAAGGGTTCTGTGTTGCCGCAGGTGTTCCCACCACCGAAAAGGCTAACGAG
ATCATTGAGGGTTTGAGGACTGCAGGTATCAAGCATATTGCGTTCAAGCCGGGTTCAGTTGACGGCCTTCGCCAA
GTGGTCAATATTGCCGCTTCGAATCCCGATTTCCCTATCATTTGTCAATGGACCGGTGGTCGTGGTGGTGGTCAC
CACTCATACGAAGATTTCCATCAGCCGATCCTTTCCACCTACCGCTCCCTTCGTAGCCACTCAAATATCGTTCTT
GTTGCTGGATCTGGTTTCGGCGACGCTGAAGACATTTGGCCGTATCTGACCGGAGACTGGTCAGAGCGTTTCGGT
GTTCAGCGGATGCCATTCGACGGGTTTTTGTTCGCCAGCCGTGTCATGGTTGCGAAAGAGGCGCATACATCATCT
TCGGTTAAGGATTTGATTGTTGCCGCTGCTGGTGTCGAGGACGAGCAATGGGAGGGCACATATACTAAGCCCACT
GGCGGCGTTTTGACCGTCCGTTCCGAGTTAGGCGAACCCATTCATAAAGTTGCGAATCGTGCAGTGAGGTTGTGG
AAGGAGTTTGACAACACTGTCTTCAGTCTTCCGAAGGAGAAGCGTGCTGCGTGGTTGAGTGAGCGTCGTGACGAA
ATTATCGAGAAGTTGAATAAGGATTTTGCCAAGCCGTGGTTTGGAGAGAAGAAGGATGGTAGTGTCGCCAAGGAA
TTGGGTGACATGACTTATGAGGAGACAGTTTTGCGCCTGGTCAGGTTGATGTATGTCTCGAAACAAAAGCGCTGG
ATCGACAGGTCCCTCCGGAACTTGACTGGTGATTGGCTGAGGCGCGTCGAAGAGCGCTTTGCTGGTGTGAACACT
ACTGGCAATAAGCCTTCACTCCTTCAATCTTATGCTTCTCTCGATGATCCCTCAGCCTTCGTCGAATCGTTTTTC
GAGGCATATCCTCTTGCCACTGAACAACTGCTCGCCGCCGACGATGTGGCATATTTCCTCGCTATTTCCCAGCGA
CCCGGTCAGAAGCCAGTTCCCTTCATCCCCGTCTTAGATGTGTCTTTTGAAGTTTGGTTTAAGAAGGTGCCTTTT
TTTTTCTAAATGGCTTGTCATCATTCGGACTCAAATCTTTTTAATCACAGGACTCCCTCTGGGCTGCTGAAGATA
TCGACGCTGTATTTGATCAAGATCCCGAGCGTGTTGCTATCCTTCAAGGTCCCGTTTCGGCGAAAGGTTCTCTTG
TCAAGGATGAGCCCATCAAGGAGCTGCTCGGCAACATCAATTCCTCTCTCATCTCCAAATTGCTCGAATCGCGTT
ATGGTGGTGATGAATCTTCTATTCCGACCATTGATTATCTCGCGGCGGAGCCATTCGTCCCTGCAACACTTTCCA
ACGTCGCTCGCTATGAGAGGGGTTCAGACGTCGTTTATCAATTTGGTTCTTCTCTTCCTTCTACTGAAGACTGGC
TCGCTGCCCTCGGCGGTTCGGAACTCAACTGGCTTCACGCCCTCGTCACTTCGGAGACCATAGTCCAGGGCACTT
CTTATATCGATAACCCTATCCGCCGTCTTCTTGCTCCACGCCCCAAACAACGCATCGTCGTTGGTTACGAGAATT
CCTTACCTGTTTCTATCACTGCTTACGGTGCCGCTCGATCTTATGGTGCCCACATCCCTGGCTTCAAGGCTGTCG
AGATTAAGTTCAACCAGTCTTCTCAACTCATCGACATCACTATGTTCGAAGAACGTCGGGATGTTGCCGTGCCCC
TCAAACTTCAATTCCATTATCAACCCGAGCAGGGCTACATGCCCATACACGAGATTGTTGACGGCCGTAACCAGC
GCATCAAAGACTTTTATTGGAAGTTGTGGTATGGTGACAATGAGGTGTTACCAAACGTCGACATCAAGGAGAAAT
TGGTTGGCCCCGAGGTCACTATTACGGCGGAGGAAGTGGAGGAGTTCTGTGCTGTGGTTGGGAATCAAGGAGAGT
CATTTAAGAATGTGAGGAATGATAGTGTGCAAGCGCCTATGGATTTCGCTATTGTTACAGGCTGGCAGGTGAGTT
GATCTGATCTTTCCTGGATATGTTCGGATGCTGACAATTTGGTAGGCTATCATGCGCTCGATTTTCCCCGCTGAC
ATCGACGGTGACCTGCTCAAGTTGGTTCATCTTTCTAATGGCTTCAAGATGGTTGAAGGCGCATCTCCTCTCAAA
GTTGGTGATATTTGCAAATCGGAAGCTCGGATCGTCTCCGTCGTCAATGCTCCGGAGGGCAAGACGGTTACGGTT
AAAGGGCACGTCTACCGGGACGATCAGCCCGTCATCGAAGTGGTCTCTTCTTTCTTATATCGCGGTCGATTCACT
GATTACGAGAACACATTCGAGACCACGGAGGAGCCTGACTATCTTGTCCCCCTTGAAACTGATGCAGAAGTCGGT
GTTCTGCAATCGAAGCAGTGGTTTGGCTGGGAGAACGAATCGACTCCTCTCCTTGCCGGGACTGCTCTCATCTTC
CGCATTCAATCATCCGTGTTTTTCAAAGATCGTGGTGTTTTCCGTAACGTTTCTGTTTCTGGTGATGTTTTCGTG
CGCAATCAGCTCAAAGTACTCGTCAAAGTTGGCAACGTCGACTTCCAGCAAGATGATTGCCAAGGCAATCCCGTC
CTCTCCTATCTGCAACGTCACGGTACTCCTCAAGGCCTCCCCACCCCTCTTGCGAACGAGGGTTACACTCTTCGA
CACGTCGAAGGTTCTACGATTTTCAACGCTCCTCTTACTAATGAGCCTTATTCTAAGATTTCTGGTGACTTCAAC
CCTATCCATGTTAACCCCTACTTTTCCGATTATGCTTCCCTTCCTACTACGATTACTCATGGCATGTGGTCGAGT
GCTGCCACTCGTCGCTACGTCGAAAATGTCGTCGCTCAAGGCCATCCCGACCGTGTCCTCGCTTACAACGTCTCG
TTCGTCGGCATGGTTCTACCCAATGACGAGCTCGAGGTGAAACTCAAGCATACTTGCATGCGGGATGGTAACATC
GTCGTCGCCATCGAAACCACTAATTCTCGCGGCGAGAAGGTCCTCGTTGGCACTGCCGAAGTTAAGCAGCCAACA
ACCGTCTACGTCTTCACTGGCCAGGGTTCTCAAGAGCCTGGTATGGGCATGGACCTTTACAACAACTCTCCTGCT
GCTCGTGCTGTCTGGGATGGTGCCGACGCTCATTTGCTCGCTACTTACGGTTTCTCTATCAGCGAAATCGTGAGG
GATAATCCCAAGGAGAAGACAATTTACTTCGGTGGTATTCAAGGTCAAGCTATCCGTCAACGTTACATGGACATG
ACCTATGATACGCTTGACAAAGACGGCAACACAAAAACTCTTCCTCTTTTTGCTGACATTGATAATCGTACTCCC
CGTTATACCTTCAGCCATCCCAATGGTCTCCTATTTGCTACCCAATTTGCTCAGATCGCTCTCGTCGTTACAGAG
AAGTCGGCGTTTGAAGACATGCGTGCGAAGGGCTTTGTTCAAAAGGACTGCGCCTTCGCTGGTCATTCGTTGGGT
GAATACTCCGCTCTCGCTTCCATCGCCGACGTTCTCCATATCTCTGCCCTCGTCGATGTTGTCTTCTACCGTGGT
ATTACCATGCAGCGTGCTGTTGAACGAGACTCTGAGAATCGCTCGAACTATGCCATGTGTGCTGTTAACCCGTCT
CGAATTTCCAAGACTTTTAGTGATGCTGCTTTGCGCGAAGTTGTTGATATGATCGCGGTCAAGACTGGATCGCTA
CTTGAAATCGTCAACTTCAACGTGGAGGTAGGTTTCTTGGTCATGATTTCTCATTTTCGGGTATTGAGCATCGTT
CTAGGGTCAACAATACGTCTGCGCCGGAGAGCTGGTTGCCCTTCAAACGATGACTAACGTTTTGAATTACCTCAA
GGTGAAGAAGGTTGATATCGCTCAGGTGAGTTGAATGATAGTTCTTGCGCAACCTGCATACTGATTTTGATCAAA
GTTGACCAAGCAATTCCCGATCGAGAAGGTCAAGCAGATGTTGGGTGATATCATCACCGAGTGCAATCAACGAGC
TCTTGATCAGCAGAAGAGCCAGGGCTATATTATCCTTGAACGTGGCTTTGCTACTATCCCCTTGCCTGGTATTGA
TGTGCCGTTCCATTCCCGTTATCTATGGGCAGGTGTTCTACCCTTCCGAGCTTGTGAGTTGATTAAATTTGGTTG
GGGTTGATTATGATACTGATGATTATGATAGATCTTTCCAAGAAAATTAACCCTGCAACTCTCAACCCCGACATG
CTCGTCGGGAAATACATTCCGAATCTTATCGCTAAACCCTTTGCTGTCTCCCGCGAGTACGCTCAAATCATCTAC
GATCAAACCTCATCCCCTCGTCTCGATAAAGTCCTCCAGAAATGGGAGGAGGACAATTGGGACAGCTCCGAAAAC
CGACAAATGCTCGCGTACATCATACTCGTTGAACTTCTCGCATACCAATTTGCTTCCCCCGTCCGATGGATCCAA
ACTCAGGATCTCCTTTTCACTCAGTATAAGTTCGAACGCCTCATTGAGTTGGGCCCGTCACCCACACTTACCGGT
ATGGCTTCTCGTACGTTGAAGGCCAAATTTGAATCGTCGGACGACTCTGTTTCGTGTACTCGTGTCATTCTTTGC
CATGCGAAGAACACCAAAGAGGTCTACTATCAATACGAGGATGAGCCTGAAGCCCCTGCCGAGGCTGCACCCGAC
GCTCCCGCCCCCGCTACTGCTGTCGCTTCAGCTGCTCCTGTCGCTGTGGCCGCTGTTGCTGTGGCCGCTGCCGGA
CCCGCTGCCAGCATCGAAGACGCACCGATCAAAGCTATCGATATTCTCCTTGTCATCGTCGCCCAGAAGTTGAAG
AAACGTGTTGATGAAGTTCCTCTTTCTAAATCTATCAAAGACCTCGTCGGAGGCAAGTCGACTCTCCAGAACGAA
ATTCTCGGGGATTTACAACAAGAATTCGCGTCTGCGCCTGAGAAAGGAGAGGAATTATCGCTTGAGGAATTGGGG
TCTGCTTTGAGTACTGGTTTCAGTGGCGCCCTTGGCAAGTACACAACGAGCCTTGTCGCTCGTCTAGTTGGTGGA
AAGATGCCCGGTGGATTCAATGCTTCTGCTATTCGTTCGTACTTGAACAAGACATGGGGCCTTGGACCTTCTCGC
GCTGATGGTGTTCTCCTTCTTGCTACCACTCTTGAGCCCCCCAAGCGTATCGCCTCCGAGGCTGAGGCAAAGACT
TGGCTCGATGGCGTTGTTCAAACCTATGCTCAGCGATCAGGTATCTCTTTGACTGCCCCTGGGGCCGCTGCTGGC
GCTGTCGGTGGAGGTGGAGGTGCCACAATCAACAGCGAGGAATTCCTCAAGTTTACGGCGGATCAAGACAAGTTC
ATCCAGCAACATATCGAGCTTTATAACCGCTACCTGAAAAAGGACTCGCGAGCTGGAGAGATTGCCTACGATCGC
GAGAAGGTTAACACCCTTGCTCTTCAGGCGAAGATTGACAGCATTACTCGTGAACATGGTGATTCTTACCTCGAC
GGTATTCAGCCCCGCTTCGATCCTTTGAAAGCCCGTCATTTCGATTCGTCCTGGAATTGGGTTCGTCAAGATGCT
CTTCTCATGTATTACGATATCATCTTTGGCCGCCTTACCACTGTTGATCGTGACATTACTGCTCGTTGCATTGCT
CTCCTCAATCGTGCCGACCCTGACATGCTCCAATATATGGAGTATCACATCAATAAGCTTGACCCCTCGAAGGGC
GACACCTACAAGTTGGCCAAGGACTTTGGTCAACAATTGATCGACAATACTCGCGACATCATTGGCAAATCTCCT
CTTTACAAAGACGGTATGCCCTTTTTCTAATATCCAGATACAAAGAAACGTCACGCTGACAATTTTTTTTCTAGT
CACCTTCCCTACCGCCCCCCACACTGAAGTCACTGCCAAGGGTGACATTGTATATTCTGAAATTGTCCGTGAAAA
TGTTCGCAAGCTCGAAGCTTACGTCGAAGAAATGGCAACCGGTGACGGCGTTGCCGGATCTGTCAACATCCAGAA
AGTTCAAGATGATGTCTTGAAGCTCTGGACCGTCGTCAAGTCGCTTCCTGAAATCAATCAGGACCAGAAGAACAG
GATCAAATCGTTGTACGAGGGCGTTGTTCGCTCTCTCCAGAAAGGTCCAGATCCCCATCCCCGCGTGCAGAGTAC
TCGCAGTCGTCGCTCCTCTTCTCAATTCCTCCGTCCTCACAATGCCGGTGTCGCAAATGTCACAGCCGACAATAT
CCCTCTGCTCCATCTCAAACGTCGCGTCGCTGCCACATGGGAGTACAGTAGTAACCTCACTGGTGTCTACCTCGA
TATCCTTCATGAGATTGCCACGTCAGGTACTACGTTTGAGGGCAAGAATGCTCTCTGCACTGGTGTCGGCAAGGG
CTCCATTGGCGTTGAGATCGTCAAAGGTCTTCTTTCTGGTGGTGCTCACGTTGTAATCACAACTTCTAGCTACAG
TCGCAAGACCGTCGAGTACTACCAATCCATTTTCCAAACCGTCGGAAGCCGTGGGTCAGCACTTACCGTTGTGCC
CTTCAATCAGGCCTCAAAACAAGACGTCGAGGCTCTCGTGGATTACATTTATAACAACCTCAATATGGATCTCGA
TTACATCCTTCCTTTCGCTGGTATTCCTGAAAACGGCCGTGAGATTGATGGACTTGATGACCGCTCTGAACTCGC
TCACCGCATGATGCTGGTCAACTTACTTCGCATCCTCGGTTGCGTCAAGAATAAGAAGGCTAATAGGCGTATCGT
CACCCGCCCCACTCAAGTTATACTCCCTCTGTCGCCTAATCATGGCCTCTTCGGTAATGATGGCCTGTATTCCGA
ATCCAAGATCTCTCTTGAGACTCTATTCCAACGATGGGCCTCGGAAAGTTGGGGTGAATATTTATGCTTGGCAGG
TGCTGTCATTGGGTGCGTAATGATTCTGGTTCATTTCTTTTGTGACTAACTAATGAATGTTCTTAGATGGACTCG
TGGCACTGGCCTTATGGCTCCTACCAATATAGTTGCTCATGAGCTCGAGGGATATGGCGTCAGGACCTTCTCTGC
TAAGGAAATGGCATTCAACATCCTCGGTTTGATGCATCCCTTGCTCTTTAGTATCACTCAAGTTGAGCCTATCTG
GGCGGATCTCAACGGTGGCATGGATCGTCTGCCAGACCTGGCCGATATCACGACTCGTATCCGCACGAACTTACT
CAAGAAGGCCGATCTTAGACGCGCCATTACCAAGGATAATGCTGCAGACTTCAAGGTCACAAATGGTGTTGAAGC
TGAACGCCTTCTTCAAACCATTGACGTCCTTCCTCGAGCCAACTTCCGTTTCGATTTCCCCGAACTTGAATCCGC
CGAATCTTTGTCTGATGTTACTCAACTGCGCGGTATGATTGATCTTGAGAAGGTTGTGGTTGTCACCGGGTTCGC
CGAGGTAGGCCCTTGGGGTAGTTCTCGTACACGTTGGGAGATGGAAGCTCGTGGAGAGTTAACAATTGAAGGATA
CATCGAGATGGCTTGGATGATGGGTTACATCAAACATTTCAACGGTCGTCTCAAAGATGGTTCGCTGTACGTTGG
ATGGGTTGATAGCAAGAGCGGTGAATCCGTAGATGATAAAGATGTTAAGGGACGCTACGAGAAGGACATTCTTGC
GCATGCTGGTATCCGTCTGATTGGTACGCCATTTACTTGATAACTCTGAACATAACATTAATTATCCCTAGAACC
CGAAATATTCCGTGGTTATGATCCCAACCGGAAGTCCTTCAACCAGGAAATCGAGCTCATACACGACCTTGAGCC
AATTGAGGTCTCAGAAGTAGAGGCACAGAAATTCAAGCTCCAGCATGGAGACAAGTGTGATATTTGGGCTGGTGA
AGATGGTCAATGGTTTGCCAAGTTGAAGAAAGGTGCATGTGTTCTCGTCCCGAAAGCTTTCAAGTTCAGCCGTAC
TGTCGCTGGACAAATTCCTAGTGGTTGGCATGCTGGACGATACGGTATCCCCGAAGATATCATTGCCCAGACCGA
TCGCTGCACTCTATGGGCGTTGGTGTGCACAGCCGAGGCTCTCAATAGTGCTGGTATCACCGACCCCTATGAGCT
CTACAAGTACATGCATCCTTCTGAAGTTGGTACCTCGCTTGGTTCCGGTATGGGTGGTGCCACGAGTATGGCCAA
GATGTTCAAAGATCGTCGTGATGAACGTGAGGTGCAAAACGATATCCTGCAAGAGACGTACGTACCCTTCCTCGC
CCTCGTATCAATATGTCCCTGACTTTATCATACAGTTTCATTAACACTACCGCTGGCTGGGTTAACTTGCTCTTG
ATGTCTTCCAGTGGACCCGTGAAGATTCCCGTAGGTGCTTGGTGAGTGAATTTGAGCACTTTCCCGAATGTGTAT
TAAGCTACCCACCACTAGTGCGACGGCTCTTCAATCTCTTGAGATTGCTTGCGATACTATTCTTTCTGGCAAAGC
TAAAGTCATGATTGCCGGAGGTTTCGATGACATCAGTGAGGAGGGTTCGTATGAGTTCGCTAACATGAAGGCTAC
CAGTAATGCGGAGACCGAATTCGCCATGGGACGAGAACCTACTGAAATGTCCCGGCCTGCTACCACTTCACGTGC
AGGGTTTATGGAGGCTCAAGGTACTGGTGTCCATATAGTCATGAGTGCCAAGACCGCCCTCGAAATTGGCGCGCC
CATCCGAGGTATACTTGCTTTCACTTCCACATCCACGTGAGTTTCTATCTTCTTATTGGCCTTTTCATTACTTAC
ACTCCCACAGTGACAAAGCTGGTCGATCAGTACCAGCTCCTGGAAAGGGTGCTCTGAGTGTTGCCCGAGAAGTTC
CATCTAAACATCCCTTGCAAATCCTCGATGTCAAATATCGCTCGCGCCAGTTGGCATTCCGCCGCACTCAAATTT
CTCAATGGCTGGATCATGAGCACGTCGAGCTTCAAGAAGAAATAACGTCACGCAAATCGGAAGGAGAGAACGTTG
ATGAAAGTTACGTCGCTTCGCGCGTAGCTAACCTGGAGAAAGAGGCTGCTCGTCAAGAGAAGGACGCTATTGCTA
TGTATGGCATGCTTGAGGGATCAGATCCTCGCGTTGCTCCCTTACGTCGTGCTCTTGCTGTCTGGGGTTTGAATG
CTGACGACATCGGCGTCCTTTCTATCCATGGCACCAGTACCGGGGCTAACGAAAAGAACGAGACGCAAATCTGGA
ACGACATCTTCACTACTATCTCCCGTAGTCGCGGAAATGCTGTTCCCATCGTCGCTCAGAAGAGCCTCCTTGGTC
ACTCTAAGGGTGGGTCCGCTGCTTGGCAGATGGCTGGTCTCTTGCAGTATGTTCTTTCCGGCGTCATCCCAGGGA
ACCGCAATAGCGAGTAAGTGATTATTAGATGCCAGTCATTTAACTTGAACTTATGTTTTTAATAGCAACATCGAC
TCCAATTTCGTTGATCGCCGATTCCTTATGTTCCCCTCTAAAACAATCTACACCGATGGTATCCAAGCTGGTGTT
ATGTCTTCCTTTGGTTTCGGTCAAGTTGGTGGAACAGCCCTCGTCGTACATCCTCGCTACCTCTTCGGTGCTCTC
GAACCGAGTTTCTACGAGCAATACAAGGAAAGAAACCGTACTCGTGCACTCCAGTCCTACAAGGCCATGAGTGAC
ATGATGGTCAAAAACTCGCTCGTGAAGATCAAGGAAAACCCACCATTCACACCCGAAAACGAACGAGAAGTACTC
ATGAACTCGATGGCGCGCGTCACTTGTGATCCCAAGACTGGCGAATATTCTTTCAAGGGCAAGCTTCCTAGAGAG
GCGCCCCTCGATCTATCAAATCTCAAACTTGTATCTGACGTCATGACCGCTCCCTCTGCCGCTACGAACAGCAAT
ATCATTGGCGTTGGTGTTGACCAAGGTAATAATCTCCCCAATCTTTTCCAATCATACCATCTCATTTGTGTTTGC
AGAGCTTATCACATCTGTTCCCTCCCACAATCCCACATTTGTTGCTCGCAACTTCACTGAGGCGGAAATAGCTTA
CTGTCGCGCTCAACCTTCGCCTGCATCCTCATTCGCGGCTCGCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCT
TGGCGTCAAGTCGGCAGGAGCTGCGGCTGTTCTGAAAGATATTGAGATTCTCAATGATGATGCCGGTGTTCCCTC
TGTTCGTCTCCATGGCGAGGCACAAGTCAAAGCGCAGGAGCGGGGAGTTGCCAACGTGTTAATTTCTTTGAGTCA
TTCTGAGGTTAGTCATGCACATGATGTCCTTATTCACGTTTATACTAACTTGGATCTCTAGACTATCGCCATTGC
TTTTGCACAAGCCTCATCAACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail