Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080600
Gene name
Locationscaffold_5:638412..638759
Strand+
Gene length (bp)347
Transcript length (bp)240
Coding sequence length (bp)240
Protein length (aa) 80

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11160 Hva1_TUDOR Hypervirulence associated proteins TUDOR domain 1.5E-20 7 75

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRL4|PRL65_SCHPO Uncharacterized protein prl65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prl65 PE=4 SV=1 1 75 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080600
MVAYKAGDRVKYHAVGGRSSGTDTSTTTGEIVDVLTEPQPAGETGVTAKASEDEPRYLIRNDNTGKETAYKGTNI
LGKC*
Coding >AgabiH97|080600
ATGGTCGCATACAAGGCTGGAGATCGCGTCAAATATCACGCTGTTGGAGGAAGAAGCTCCGGCACCGACACTTCT
ACCACTACTGGTGAAATAGTCGACGTTCTCACTGAGCCCCAACCTGCTGGGGAAACCGGCGTGACCGCAAAGGCC
TCCGAAGATGAGCCGCGCTATCTCATTCGTAACGATAACACGGGCAAAGAGACTGCCTATAAGGGTACCAATATT
CTTGGAAAGTGCTGA
Transcript >AgabiH97|080600
ATGGTCGCATACAAGGCTGGAGATCGCGTCAAATATCACGCTGTTGGAGGAAGAAGCTCCGGCACCGACACTTCT
ACCACTACTGGTGAAATAGTCGACGTTCTCACTGAGCCCCAACCTGCTGGGGAAACCGGCGTGACCGCAAAGGCC
TCCGAAGATGAGCCGCGCTATCTCATTCGTAACGATAACACGGGCAAAGAGACTGCCTATAAGGGTACCAATATT
CTTGGAAAGTGCTGA
Gene >AgabiH97|080600
ATGGTCGCATACAAGGTGAGTAAACGCAGAGATTTTTTTTTCGCCTCGTCTCAACCGTCCATTCTCAAAGGCTGG
AGATCGCGTCAAATATCACGCTGTTGGAGGAAGAAGCTCCGGCACCGACACTTCTACCACTACTGGTGAAATAGT
CGACGTTCTCACTGAGCCCCAACCTGCTGGGGAAACCGGCGTGACCGCAAAGGTTTGTTTTCTTTCACATATTCG
ACTTTGAGCAGGATTTGATGATAATTCAGGCCTCCGAAGATGAGCCGCGCTATCTCATTCGTAACGATAACACGG
GCAAAGAGACTGCCTATAAGGGTACCAATATTCTTGGAAAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail