Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080490
Gene name
Locationscaffold_5:613031..614950
Strand+
Gene length (bp)1919
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-34 47 478

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 27 493 4.0E-36
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 27 511 6.0E-35
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 11 511 1.0E-32
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 37 507 4.0E-31
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 63 200 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 27 493 4.0E-36
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 27 511 6.0E-35
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 11 511 1.0E-32
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 37 507 4.0E-31
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 63 200 5.0E-09
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 58 260 3.0E-08
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 58 260 4.0E-08
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 63 285 6.0E-08
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 58 239 7.0E-08
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 63 200 1.0E-07
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 85 250 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 81 103 22
3 113 132 19
4 172 194 22
5 214 236 22
6 323 345 22
7 360 382 22
8 395 414 19
9 429 451 22
10 458 480 22
11 495 517 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080490
MTNAPDTVIHEETSAAIATPPNEQAVVEGAEQPRTPLPKFQLGLVMLIQFAEPITALVIYPFINQFVQATGVTGG
DDRKTGYYAGIIESAFFLAEAATVFYWGRLSDRIGRRPVLMIGPLGLTFAMLKFGYSKSFLSMVISRCFQGVFNG
NIGVSKTVMVELTDETNIGDAFAMMPLMWSIGSTVAPIMGGGLSNPAERWPNVFGKMETFRSHPYFLPCLVSASI
ALISFVIAVLGFKETHPTLARSKSEEKDPIKDPEISQVSSTDSLLGHNDPADYGTTSTRRSPSPSSSESSMDSCN
KIGKLNSEAPTLSSILSSKKMQFIIINYLFLTFSDMAYSVLMPLIYSTKIEHGGLGLNPYQIGMTMGIWGFVNAF
VQINLLGKLIRKYGSARMYRYAYASFCVCLLTYPVSTYLARRNGGISVGVCISILVQLVFQFPLYMGYGAIHVVI
AESSPKSILGSINGIVQMAGCTMRTVAPTIASSLFSISLQKRLLGGNFVYVVLYAVILVGVRSSLYLPERKKGTA
RL*
Coding >AgabiH97|080490
ATGACCAACGCCCCCGATACTGTCATCCATGAAGAGACTTCTGCAGCAATTGCTACCCCTCCAAATGAACAGGCG
GTAGTAGAGGGTGCAGAGCAACCGCGGACGCCGCTCCCAAAATTCCAACTGGGCCTTGTAATGCTCATCCAATTT
GCTGAACCTATCACCGCTCTCGTCATTTATCCGTTCATCAATCAGTTTGTACAGGCAACAGGAGTCACTGGAGGG
GATGACAGGAAAACAGGTTATTACGCTGGAATCATTGAATCGGCTTTCTTTCTTGCTGAAGCCGCCACCGTCTTT
TACTGGGGTCGTTTGTCCGATCGCATTGGCAGAAGACCTGTGTTGATGATTGGGCCCCTCGGCCTCACCTTTGCA
ATGTTGAAATTTGGATATTCAAAATCGTTTTTGTCCATGGTAATCTCTCGTTGTTTCCAAGGCGTTTTCAATGGC
AACATCGGGGTATCAAAAACTGTTATGGTAGAGTTGACGGACGAAACGAACATCGGAGACGCGTTCGCTATGATG
CCATTGATGTGGAGTATAGGTTCAACCGTTGCCCCGATCATGGGTGGTGGTTTGAGTAACCCAGCAGAAAGGTGG
CCCAACGTTTTCGGCAAAATGGAAACTTTCAGAAGCCACCCTTACTTCTTACCCTGCCTGGTCTCTGCATCTATT
GCTCTAATCAGCTTCGTAATCGCTGTCTTAGGATTCAAGGAGACCCATCCTACCCTAGCACGCTCGAAGTCGGAA
GAGAAAGACCCGATAAAGGACCCCGAAATTTCGCAGGTCAGCTCTACAGATAGTCTTCTGGGCCATAACGATCCG
GCCGACTATGGTACAACCTCTACGCGCCGGTCTCCTTCCCCCTCATCTTCTGAATCTTCTATGGATTCGTGTAAC
AAAATCGGAAAGCTCAATTCTGAAGCCCCGACCTTAAGCTCCATTCTCAGCTCCAAGAAGATGCAATTTATCATC
ATCAACTACCTTTTCCTTACCTTCTCGGATATGGCTTACTCGGTTCTTATGCCACTAATTTATTCTACCAAAATT
GAACACGGTGGTTTGGGTCTTAACCCATACCAAATCGGTATGACCATGGGCATTTGGGGCTTTGTCAACGCCTTT
GTCCAAATCAACTTGCTTGGAAAACTGATCAGGAAATACGGTTCGGCTCGGATGTATAGATATGCCTATGCTTCC
TTCTGCGTATGCCTCCTGACATATCCCGTCTCTACTTACCTTGCTCGTCGCAATGGAGGGATCAGCGTCGGAGTT
TGCATTTCCATATTGGTCCAGCTTGTATTCCAATTTCCCTTATACATGGGTTACGGTGCAATTCATGTTGTCATC
GCCGAATCTTCTCCGAAATCGATACTCGGGTCTATAAATGGTATAGTGCAGATGGCAGGATGTACTATGCGAACC
GTCGCCCCCACTATTGCTTCGTCCTTATTCTCCATCTCTTTGCAAAAGCGCCTCTTAGGCGGGAACTTCGTTTAT
GTTGTTTTGTACGCGGTGATCCTTGTCGGGGTCCGGTCTAGTCTATATTTGCCGGAGCGCAAAAAGGGGACTGCT
CGTCTTTAG
Transcript >AgabiH97|080490
ATGACCAACGCCCCCGATACTGTCATCCATGAAGAGACTTCTGCAGCAATTGCTACCCCTCCAAATGAACAGGCG
GTAGTAGAGGGTGCAGAGCAACCGCGGACGCCGCTCCCAAAATTCCAACTGGGCCTTGTAATGCTCATCCAATTT
GCTGAACCTATCACCGCTCTCGTCATTTATCCGTTCATCAATCAGTTTGTACAGGCAACAGGAGTCACTGGAGGG
GATGACAGGAAAACAGGTTATTACGCTGGAATCATTGAATCGGCTTTCTTTCTTGCTGAAGCCGCCACCGTCTTT
TACTGGGGTCGTTTGTCCGATCGCATTGGCAGAAGACCTGTGTTGATGATTGGGCCCCTCGGCCTCACCTTTGCA
ATGTTGAAATTTGGATATTCAAAATCGTTTTTGTCCATGGTAATCTCTCGTTGTTTCCAAGGCGTTTTCAATGGC
AACATCGGGGTATCAAAAACTGTTATGGTAGAGTTGACGGACGAAACGAACATCGGAGACGCGTTCGCTATGATG
CCATTGATGTGGAGTATAGGTTCAACCGTTGCCCCGATCATGGGTGGTGGTTTGAGTAACCCAGCAGAAAGGTGG
CCCAACGTTTTCGGCAAAATGGAAACTTTCAGAAGCCACCCTTACTTCTTACCCTGCCTGGTCTCTGCATCTATT
GCTCTAATCAGCTTCGTAATCGCTGTCTTAGGATTCAAGGAGACCCATCCTACCCTAGCACGCTCGAAGTCGGAA
GAGAAAGACCCGATAAAGGACCCCGAAATTTCGCAGGTCAGCTCTACAGATAGTCTTCTGGGCCATAACGATCCG
GCCGACTATGGTACAACCTCTACGCGCCGGTCTCCTTCCCCCTCATCTTCTGAATCTTCTATGGATTCGTGTAAC
AAAATCGGAAAGCTCAATTCTGAAGCCCCGACCTTAAGCTCCATTCTCAGCTCCAAGAAGATGCAATTTATCATC
ATCAACTACCTTTTCCTTACCTTCTCGGATATGGCTTACTCGGTTCTTATGCCACTAATTTATTCTACCAAAATT
GAACACGGTGGTTTGGGTCTTAACCCATACCAAATCGGTATGACCATGGGCATTTGGGGCTTTGTCAACGCCTTT
GTCCAAATCAACTTGCTTGGAAAACTGATCAGGAAATACGGTTCGGCTCGGATGTATAGATATGCCTATGCTTCC
TTCTGCGTATGCCTCCTGACATATCCCGTCTCTACTTACCTTGCTCGTCGCAATGGAGGGATCAGCGTCGGAGTT
TGCATTTCCATATTGGTCCAGCTTGTATTCCAATTTCCCTTATACATGGGTTACGGTGCAATTCATGTTGTCATC
GCCGAATCTTCTCCGAAATCGATACTCGGGTCTATAAATGGTATAGTGCAGATGGCAGGATGTACTATGCGAACC
GTCGCCCCCACTATTGCTTCGTCCTTATTCTCCATCTCTTTGCAAAAGCGCCTCTTAGGCGGGAACTTCGTTTAT
GTTGTTTTGTACGCGGTGATCCTTGTCGGGGTCCGGTCTAGTCTATATTTGCCGGAGCGCAAAAAGGGGACTGCT
CGTCTTTAG
Gene >AgabiH97|080490
ATGACCAACGCCCCCGATACTGTCATCCATGAAGAGACTTCTGCAGCAATTGCTACCCCTCCAAATGAACAGGCG
GTAGTAGAGGGTGCAGAGCAACCGCGGACGCCGCTCCCAAAATTCCAACTGGGCCTTGTAATGCTCATCCAATTT
GCTGAACCTATCACCGCTCTCGTCATTTATCCGTTCATCAATCAGTTTGTACAGGCAACAGGAGTCACTGGAGGG
GATGACAGGAAAACAGGTTATTACGCTGGAATCATTGTGAGTGGTGCGACCTCGTATGACCCGACGCGCTCATTA
TTTACCCCTACGCTAAGGAATCGGCTTTCTTTCTTGCTGAAGCCGCCACCGTCTTTTACTGGGGTCGTTTGTCCG
ATCGCATTGGCAGAAGACCTGTGTTGATGATTGGGCCCCTCGGCCTCACCTTTGCAATGTTGAAATTTGGATATT
CAAAATCGTTTTTGTCCATGGTAATCTCTCGTTGTTTCCAAGGCGTTTTCAATGGCAACATCGGTGCGTTAAAAT
TGTTAAATTATACCCTGTATTTTATTCAACACCACATAAGGGGTATCAAAAACTGTTATGGTAGAGGTACGATTC
TCCCGAAATGTTTGACACCCGTGGTACTTAATCTATCTAGTTGACGGACGAAACGAACATCGGAGACGCGTTCGC
TATGATGCCATTGATGTGGAGTATAGGTTCAACCGTTGCGTGAGTTAGATGCATTCTTCATCTATTTGAGCGTGT
GCTCATTCATGTGCTCAGCCCGATCATGGGTGGTGGTTTGAGTAACCCAGCAGAAAGGTGGCCCAACGTTTTCGG
CAAAATGGAAACTTTCAGAAGCCACCCTTACTTCTTACCCTGCCTGGTCTCTGCATCTATTGCTCTAATCAGCTT
CGTAATCGCTGTCTTAGGATTCAAGGAGGTACGGACGGATTTTCCTATTTTGGGATTTTGGTTGCGTTTATTCAC
GTTGCATGCATACTAGACCCATCCTACCCTAGCACGCTCGAAGTCGGAAGAGAAAGACCCGATAAAGGACCCCGA
AATTTCGCAGGTCAGCTCTACAGATAGTCTTCTGGGCCATAACGATCCGGCCGACTATGGTACAACCTCTACGCG
CCGGTCTCCTTCCCCCTCATCTTCTGAATCTTCTATGGATTCGTGTAACAAAATCGGAAAGCTCAATTCTGAAGC
CCCGACCTTAAGCTCCATTCTCAGCTCCAAGAAGATGCAATTTATCATCATCAACTACCTTTTCCTTACCTTCTC
GGATATGGCTTACTCGGTTCTTATGCCACTAATTTATTCTACCAAAATTGAACACGGTGGTTTGGGTCTTAACCC
ATACCAAATCGGTATGACCATGGGCATTTGGGGCTTTGTCAACGCCTTTGTCCAAATCAACTTGCTTGGAAAACT
GATCAGGAAATACGGTTCGGCTCGGATGTATAGATATGCCTATGCTTCCTTCTGCGTATGCCTCCTGACATATCC
CGTCTCTACTTACCTTGCTCGTCGCAATGGAGGGATCAGCGTCGGAGTTTGCATTTCCATATTGGTCCAGCTTGT
ATTCCAATTTCCCTTATACATGGGTTACGGTATGTACCTGCTGTCATCCATTTGTCTTGATCTGGCAAGCTAACT
TTAGTTATCTTCCAGGTGCAATTCATGTTGTCATCGCCGAATCTTCTCCGAAATCGATACTCGGGTCTATAAATG
GTATAGTGCAGATGGCAGGATGTACTATGCGAACCGTCGCCCCCACTATTGCTTCGTCCTTATTCTCCATCTCTT
TGCAAAAGCGCCTCTTAGGCGGGAACTTCGTTTATGTTGTTTTGTACGCGGTGATCCTTGTCGGGGTCCGGTCTA
GTCTATATTTGCCGGAGCGCAAAAAGGGGACTGCTCGTCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail