Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080470
Gene name
Locationscaffold_5:606131..607612
Strand-
Gene length (bp)1481
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 2.8E-19 55 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53693|RDS1_SCHPO Protein rds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rds1 PE=2 SV=2 24 374 7.0E-129

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080470
MITLPVLLVLLSGAHIFGAAKPVFAQENMTEPFKPSGGLGTNSTPPEYVPMSDFDFQSLNLALNQEWIELDLFHH
GLAMFSDADFDAAGLGPEDRYLIQFMAEQEVGHATLISNMLQGRGAKPCTYRYPFKTVREFVDFCQKLTRWGESG
VYGFLEHLNSRAAATLLLDSITTEARQQLIFRQFEGLFPMDIWFVPGIPQSMAWTLLQPYIATCPAENPRVEFQI
FPALNVTNNPDATPLYNTSIVGNDTTPAIARNRTIPLSAPGRTVQLSWEEPGRPAGYNNSYTTNTTAGDPKFALW
ISQINSTYTPLENITGNTASTTQPGGMVFGEGTAPIYNGTIFVAITDTDLSVTPFNISMVNKHVVAGPAIYQAG*
Coding >AgabiH97|080470
ATGATCACTCTTCCTGTGCTCCTCGTTCTGCTGTCCGGCGCTCATATCTTCGGCGCGGCCAAGCCAGTATTCGCC
CAAGAAAATATGACCGAGCCATTTAAACCGTCGGGTGGATTGGGAACTAATTCTACTCCCCCCGAATATGTCCCT
ATGAGCGACTTCGATTTCCAGTCACTGAATCTTGCTCTCAATCAAGAATGGATTGAGCTCGACCTCTTCCATCAT
GGCCTCGCCATGTTCTCAGACGCGGATTTCGATGCCGCAGGGCTCGGCCCCGAGGATCGCTATTTGATCCAGTTC
ATGGCTGAACAAGAAGTCGGGCACGCGACCCTTATTTCGAATATGTTGCAAGGTCGCGGCGCTAAGCCTTGTACA
TACCGGTATCCATTCAAAACTGTCCGAGAGTTCGTCGACTTTTGCCAAAAGCTTACACGTTGGGGCGAATCCGGT
GTTTATGGTTTCCTCGAGCACCTGAATTCGCGTGCTGCGGCTACCCTTTTACTGGATTCCATCACTACGGAGGCG
CGTCAGCAACTTATTTTCCGTCAATTTGAGGGTTTGTTCCCAATGGATATTTGGTTTGTGCCGGGCATCCCACAG
TCAATGGCGTGGACTCTCTTACAACCCTATATTGCCACCTGTCCAGCTGAAAATCCTCGCGTTGAATTCCAAATT
TTCCCGGCACTGAATGTCACGAACAACCCCGATGCTACTCCGCTTTACAACACATCCATAGTTGGCAATGACACC
ACACCAGCAATCGCACGCAACCGAACAATTCCACTGTCAGCCCCTGGCAGGACAGTTCAACTGAGTTGGGAGGAG
CCCGGTAGACCTGCTGGCTATAACAATAGTTATACCACCAACACTACTGCGGGGGATCCAAAGTTTGCGTTATGG
ATTTCTCAAATCAACTCCACCTACACGCCGCTAGAGAACATTACAGGTAACACGGCTTCTACCACTCAACCAGGA
GGTATGGTATTCGGCGAAGGCACTGCGCCCATCTATAATGGTACTATATTCGTCGCTATTACCGACACAGATTTA
TCGGTGACTCCATTCAATATTTCGATGGTCAACAAGCACGTTGTCGCAGGTCCGGCCATCTACCAAGCTGGGTAA
Transcript >AgabiH97|080470
ATGATCACTCTTCCTGTGCTCCTCGTTCTGCTGTCCGGCGCTCATATCTTCGGCGCGGCCAAGCCAGTATTCGCC
CAAGAAAATATGACCGAGCCATTTAAACCGTCGGGTGGATTGGGAACTAATTCTACTCCCCCCGAATATGTCCCT
ATGAGCGACTTCGATTTCCAGTCACTGAATCTTGCTCTCAATCAAGAATGGATTGAGCTCGACCTCTTCCATCAT
GGCCTCGCCATGTTCTCAGACGCGGATTTCGATGCCGCAGGGCTCGGCCCCGAGGATCGCTATTTGATCCAGTTC
ATGGCTGAACAAGAAGTCGGGCACGCGACCCTTATTTCGAATATGTTGCAAGGTCGCGGCGCTAAGCCTTGTACA
TACCGGTATCCATTCAAAACTGTCCGAGAGTTCGTCGACTTTTGCCAAAAGCTTACACGTTGGGGCGAATCCGGT
GTTTATGGTTTCCTCGAGCACCTGAATTCGCGTGCTGCGGCTACCCTTTTACTGGATTCCATCACTACGGAGGCG
CGTCAGCAACTTATTTTCCGTCAATTTGAGGGTTTGTTCCCAATGGATATTTGGTTTGTGCCGGGCATCCCACAG
TCAATGGCGTGGACTCTCTTACAACCCTATATTGCCACCTGTCCAGCTGAAAATCCTCGCGTTGAATTCCAAATT
TTCCCGGCACTGAATGTCACGAACAACCCCGATGCTACTCCGCTTTACAACACATCCATAGTTGGCAATGACACC
ACACCAGCAATCGCACGCAACCGAACAATTCCACTGTCAGCCCCTGGCAGGACAGTTCAACTGAGTTGGGAGGAG
CCCGGTAGACCTGCTGGCTATAACAATAGTTATACCACCAACACTACTGCGGGGGATCCAAAGTTTGCGTTATGG
ATTTCTCAAATCAACTCCACCTACACGCCGCTAGAGAACATTACAGGTAACACGGCTTCTACCACTCAACCAGGA
GGTATGGTATTCGGCGAAGGCACTGCGCCCATCTATAATGGTACTATATTCGTCGCTATTACCGACACAGATTTA
TCGGTGACTCCATTCAATATTTCGATGGTCAACAAGCACGTTGTCGCAGGTCCGGCCATCTACCAAGCTGGGTAA
Gene >AgabiH97|080470
ATGATCACTCTTCCTGTGCTCCTCGTTCTGCTGTCCGGCGCTCATATCTTCGGCGCGGCCAAGCCAGTATTCGCC
CAAGAAAATATGACCGAGCCATTTAAACCGTCGGGTGGATTGGGAACTAATTCTACTCCCCCCGAATATGTCCCT
ATGAGCGACTTCGATTTCCAGTCACTGGTAAGCCTTTAATCTTTCTGATCAGGCCTCAACTTATGCATTTGTGCA
GAATCTTGCTCTCAATCAAGAATGGATTGAGCTCGACCTCTTCCATCATGGCCTCGCCATGTTCTCAGACGCGGA
TTTCGATGCCGCAGGGCTCGGCCCCGAGGATCGCTATTTGATCCAGTTCATGGCTGAACAAGAAGTCGGGCACGC
GACCCTTATTTCGAATATGTTGCAAGGTATATCAGTTGGTATATGACTTACAATGTTGTTAATTCCTTGCGCAGG
TCGCGGCGCTAAGCCTTGTACATACCGGTATCCATTCAAAACTGTCCGAGAGTTCGTCGACTTTTGCCAAAAGGT
GCGCATCACATTTATTGATACTTCACCGTCCCCGCTGACATTAAATCAGCTTACACGTTGGGGCGAATCCGGTGT
TTATGGTTTCCTCGAGCACCTGAATTCGCGTGCTGCGGCTACCCTTTTACTGGATTCCATCACTACGGAGGCGCG
TCAGCAACTTATTTTCCGTCAATTTGAGGGTTTGTTCCCAATGGATGTCAGTGTCCTTCCTCACCCGCGGCCTTT
ATACTATGCTAAACTGCTCTATCTAGATTTGGTTTGTGCCGGGCATCCCACAGTCAATGGCGTGGACTCTCTTAC
AACCCTATATTGCCACCTGTCCAGCTGAAAATCCTCGCGTTGAATTCCAAATTTTCCCGGCACTGAATGTCACGG
TAGGGTATCTTCTCCCCTATACAATTATCCTGCTTAGGTATTCGCGCAGAACAACCCCGATGCTACTCCGCTTTA
CAACACATCCATAGTTGGCAATGACACCACACCAGCAATCGCACGCAACCGAACAATTCCACTGTCAGCCCCTGG
CAGGACAGTTCAACTGAGTTGGGAGGAGCCCGGTAGACCTGCTGGCTATAACAATAGTTATACCACCAACACTAC
TGCGGGGGATCCAAAGGTGCGCATTCCATCTCGTACGGCACGTTCATACGTTTAATTTTTCGATAGTTTGCGTTA
TGGATTTCTCAAATCAACTCCACCTACACGCCGCTAGAGAACATTACAGGTAACACGGCTTCTACCACTCAACCA
GGAGGTATGGTATTCGGCGAAGGCACTGCGCCCATCTATAATGGTACTATGTATGTACTGTCTCAAGTCATTATC
CTCGATATCATGTCTTACTCCTCTTCAGATTCGTCGCTATTACCGACACAGATTTATCGGTGACTCCATTCAATA
TTTCGATGGTCAACAAGCACGTTGTCGCAGGTCCGGCCATCTACCAAGCTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail