Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080380
Gene name
Locationscaffold_5:580535..582464
Strand-
Gene length (bp)1929
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-19 34 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 9 439 2.0E-46
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 15 464 2.0E-42
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 15 454 3.0E-36
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 25 261 5.0E-27
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 28 384 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 9 439 2.0E-46
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 15 464 2.0E-42
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 15 454 3.0E-36
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 25 261 5.0E-27
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 28 384 2.0E-11
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 46 195 5.0E-11
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 46 195 5.0E-11
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 46 195 5.0E-11
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 46 195 5.0E-11
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 46 195 5.0E-11
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 46 195 5.0E-11
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 46 195 7.0E-11
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 45 363 1.0E-10
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 31 368 3.0E-10
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 45 198 2.0E-09
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 46 344 3.0E-09
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 32 230 7.0E-09
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 46 183 1.0E-08
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 94 212 2.0E-08
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 73 212 7.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 46 244 7.0E-08
sp|A7ZZ10|MDTG_ECOHS Multidrug resistance protein MdtG OS=Escherichia coli O9:H4 (strain HS) GN=mdtG PE=3 SV=1 20 388 1.0E-07
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 58 177 1.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 46 244 2.0E-07
sp|B7NAS9|MDTG_ECOLU Multidrug resistance protein MdtG OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtG PE=3 SV=1 20 388 2.0E-07
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 73 212 2.0E-07
sp|B1LIV8|MDTG_ECOSM Multidrug resistance protein MdtG OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtG PE=3 SV=1 20 388 7.0E-07
sp|Q8FIR9|MDTG_ECOL6 Multidrug resistance protein MdtG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtG PE=3 SV=1 20 388 8.0E-07
sp|Q0TJ20|MDTG_ECOL5 Multidrug resistance protein MdtG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtG PE=3 SV=1 20 388 8.0E-07
sp|B6I9D0|MDTG_ECOSE Multidrug resistance protein MdtG OS=Escherichia coli (strain SE11) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|A7ZKF6|MDTG_ECO24 Multidrug resistance protein MdtG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|Q8X9I3|MDTG_ECO57 Multidrug resistance protein MdtG OS=Escherichia coli O157:H7 GN=mdtG PE=3 SV=2 20 388 9.0E-07
sp|B7M928|MDTG_ECO8A Multidrug resistance protein MdtG OS=Escherichia coli O8 (strain IAI1) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|C4ZRZ3|MDTG_ECOBW Multidrug resistance protein MdtG OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|B1X9G6|MDTG_ECODH Multidrug resistance protein MdtG OS=Escherichia coli (strain K12 / DH10B) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|B1IV49|MDTG_ECOLC Multidrug resistance protein MdtG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|P25744|MDTG_ECOLI Multidrug resistance protein MdtG OS=Escherichia coli (strain K12) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|B7UP67|MDTG_ECO27 Multidrug resistance protein MdtG OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|B7MIJ4|MDTG_ECO45 Multidrug resistance protein MdtG OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|A1A9U9|MDTG_ECOK1 Multidrug resistance protein MdtG OS=Escherichia coli O1:K1 / APEC GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|Q1RDA5|MDTG_ECOUT Multidrug resistance protein MdtG OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtG PE=3 SV=1 20 388 9.0E-07
sp|B7LFG4|MDTG_ECO55 Multidrug resistance protein MdtG OS=Escherichia coli (strain 55989 / EAEC) GN=mdtG PE=3 SV=1 20 388 2.0E-06
sp|B7MTI5|MDTG_ECO81 Multidrug resistance protein MdtG OS=Escherichia coli O81 (strain ED1a) GN=mdtG PE=3 SV=1 45 388 3.0E-06
sp|B7NL82|MDTG_ECO7I Multidrug resistance protein MdtG OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtG PE=3 SV=1 45 388 3.0E-06
sp|D2BX50|MDTG_DICD5 Multidrug resistance protein MdtG OS=Dickeya dadantii (strain Ech586) GN=mdtG PE=3 SV=1 46 309 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 102 124 22
3 203 225 22
4 269 291 22
5 315 334 19
6 346 368 22
7 383 405 22
8 412 434 22
9 449 471 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080380
MTATETPVDEETPLLQQQPKKKTPLPWSQYSLVLLLQLGEPMTSQVIYPFAPQLIRDLGITGGDETKVGYYVGIM
QSLFFFTQAWTVLHWSRLSDRVGRKPVILIGLFGLSMSMYCFGLSTTFWGLVMSRALNGALNGNIGVIKSMMAEL
TDSTNIAQAYAYMPIAWSTGGTLGPIIGGSLSHPAERFPSLFGNSEFLKKYPYFLPCAVPATYTVCAWLITYIFL
KETVQRPTSFRNLIFGSDKKLKLEQNQVATVDDSDDKPLPLRSLLVFRVIIAASNYAFLSLVDIAFRAIQPVFLS
TPIELGGLGLPPSTIGNILSVYGVLNGFIQIFFFAKMHDRWGSKKVFTAGIAACIPMFLLFPIINYLARSQGLTP
LVWGFVSLQVGLAMMPSLSFSSIFIFITAASPNKASLGATNGLCQVAVSVMRAFGPAAANSLFSLSMAYNLLGGY
LVYYILVVIVGIALFVASILPSSV*
Coding >AgabiH97|080380
ATGACTGCCACAGAAACCCCTGTTGACGAGGAGACACCTTTGTTGCAACAGCAGCCGAAGAAGAAAACGCCCCTA
CCATGGTCTCAATATTCACTTGTTTTGCTTTTGCAACTAGGCGAACCAATGACTTCACAGGTCATCTACCCGTTC
GCTCCTCAGCTCATTCGGGATCTCGGTATCACCGGCGGTGATGAAACTAAAGTGGGGTATTATGTTGGAATCATG
CAATCTCTGTTCTTCTTCACGCAAGCGTGGACTGTTCTTCACTGGAGTCGGCTGTCGGATAGAGTGGGCCGTAAA
CCGGTCATTCTAATCGGTCTCTTCGGCCTTTCTATGTCCATGTATTGCTTCGGCTTGTCAACGACATTTTGGGGG
CTTGTCATGAGTCGGGCTTTGAACGGAGCTCTAAATGGCAACATTGGAGTGATCAAAAGCATGATGGCAGAGTTG
ACCGATTCGACAAACATTGCCCAAGCTTATGCATACATGCCGATAGCATGGTCAACCGGTGGAACTTTAGGTCCA
ATTATTGGAGGATCCCTCTCACATCCAGCAGAACGATTCCCTTCCCTATTCGGGAACAGTGAATTCCTCAAAAAA
TACCCTTACTTTTTGCCTTGTGCAGTTCCGGCCACGTACACCGTCTGCGCCTGGCTTATTACTTATATCTTCTTG
AAAGAGACAGTTCAGCGTCCGACATCTTTCCGAAACCTTATTTTTGGATCTGATAAAAAGCTCAAGCTTGAACAA
AATCAAGTTGCGACCGTTGACGATAGCGATGACAAACCTCTTCCTTTACGATCTCTGTTGGTGTTTCGAGTCATC
ATCGCTGCAAGCAATTACGCTTTCCTTTCTTTGGTCGACATTGCTTTCCGTGCAATTCAACCGGTGTTCCTTTCG
ACTCCTATTGAATTGGGTGGACTGGGACTTCCTCCTTCCACGATTGGAAATATTTTATCCGTGTATGGGGTTCTC
AATGGTTTCATCCAGATCTTTTTCTTCGCCAAAATGCACGATCGCTGGGGCTCGAAAAAGGTTTTTACAGCCGGC
ATTGCCGCGTGTATCCCTATGTTTCTTCTCTTCCCCATCATCAACTATTTAGCACGTTCGCAAGGATTGACCCCA
TTGGTATGGGGCTTTGTATCTCTACAGGTCGGCTTGGCTATGATGCCAAGCTTGTCGTTCAGCTCCATTTTCATT
TTTATCACAGCAGCGTCCCCTAACAAGGCTTCTCTTGGCGCTACCAATGGATTGTGTCAGGTGGCTGTCAGTGTG
ATGCGGGCATTCGGCCCTGCAGCGGCGAATTCGTTGTTTTCGCTGTCGATGGCATATAACTTGTTGGGTGGATAT
CTCGTCTATTACATACTTGTTGTAATTGTTGGTATTGCGCTTTTTGTAGCGTCTATTTTGCCGAGCTCTGTATGA
Transcript >AgabiH97|080380
ATGACTGCCACAGAAACCCCTGTTGACGAGGAGACACCTTTGTTGCAACAGCAGCCGAAGAAGAAAACGCCCCTA
CCATGGTCTCAATATTCACTTGTTTTGCTTTTGCAACTAGGCGAACCAATGACTTCACAGGTCATCTACCCGTTC
GCTCCTCAGCTCATTCGGGATCTCGGTATCACCGGCGGTGATGAAACTAAAGTGGGGTATTATGTTGGAATCATG
CAATCTCTGTTCTTCTTCACGCAAGCGTGGACTGTTCTTCACTGGAGTCGGCTGTCGGATAGAGTGGGCCGTAAA
CCGGTCATTCTAATCGGTCTCTTCGGCCTTTCTATGTCCATGTATTGCTTCGGCTTGTCAACGACATTTTGGGGG
CTTGTCATGAGTCGGGCTTTGAACGGAGCTCTAAATGGCAACATTGGAGTGATCAAAAGCATGATGGCAGAGTTG
ACCGATTCGACAAACATTGCCCAAGCTTATGCATACATGCCGATAGCATGGTCAACCGGTGGAACTTTAGGTCCA
ATTATTGGAGGATCCCTCTCACATCCAGCAGAACGATTCCCTTCCCTATTCGGGAACAGTGAATTCCTCAAAAAA
TACCCTTACTTTTTGCCTTGTGCAGTTCCGGCCACGTACACCGTCTGCGCCTGGCTTATTACTTATATCTTCTTG
AAAGAGACAGTTCAGCGTCCGACATCTTTCCGAAACCTTATTTTTGGATCTGATAAAAAGCTCAAGCTTGAACAA
AATCAAGTTGCGACCGTTGACGATAGCGATGACAAACCTCTTCCTTTACGATCTCTGTTGGTGTTTCGAGTCATC
ATCGCTGCAAGCAATTACGCTTTCCTTTCTTTGGTCGACATTGCTTTCCGTGCAATTCAACCGGTGTTCCTTTCG
ACTCCTATTGAATTGGGTGGACTGGGACTTCCTCCTTCCACGATTGGAAATATTTTATCCGTGTATGGGGTTCTC
AATGGTTTCATCCAGATCTTTTTCTTCGCCAAAATGCACGATCGCTGGGGCTCGAAAAAGGTTTTTACAGCCGGC
ATTGCCGCGTGTATCCCTATGTTTCTTCTCTTCCCCATCATCAACTATTTAGCACGTTCGCAAGGATTGACCCCA
TTGGTATGGGGCTTTGTATCTCTACAGGTCGGCTTGGCTATGATGCCAAGCTTGTCGTTCAGCTCCATTTTCATT
TTTATCACAGCAGCGTCCCCTAACAAGGCTTCTCTTGGCGCTACCAATGGATTGTGTCAGGTGGCTGTCAGTGTG
ATGCGGGCATTCGGCCCTGCAGCGGCGAATTCGTTGTTTTCGCTGTCGATGGCATATAACTTGTTGGGTGGATAT
CTCGTCTATTACATACTTGTTGTAATTGTTGGTATTGCGCTTTTTGTAGCGTCTATTTTGCCGAGCTCTGTATGA
Gene >AgabiH97|080380
ATGACTGCCACAGAAACCCCTGTTGACGAGGAGACACCTTTGTTGCAACAGCAGCCGAAGAAGAAAACGCCCCTA
CCATGGTCTCAATATTCACTTGTTTTGCTTTTGCAACTAGGCGAACCAATGACTTCACAGGTCATCTACCCGTTC
GCTCCTCAGGCAAGACTTATCTGCTTCAATTGAATTGTGATTCAAATCATATAAATGAATGATGGTCTTCAGCTC
ATTCGGGATCTCGGTATCACCGGCGGTGATGAAACTAAAGTGGGGTATTATGTTGGAATCATGGTTTGTGCTATT
TTTTGTCTATTGAGCTAATGGTCAACTGACGAGTCCACCTGCCAGCAATCTCTGTTCTTCTTCACGCAAGCGTGG
ACTGTTCTTCACTGGAGTCGGCTGTCGGATAGAGTGGGCCGTAAACCGGTCATTCTAATCGGTCTCTTCGGCCTT
TCTATGTCCATGTATTGCTTCGGCTTGTCAACGACATTTTGGGGGCTTGTCATGAGGTAAGTCATGAGCATACTG
TGGCTTCGATAATGAATTTCATGTGTTTGTTCAACAGTCGGGCTTTGAACGGAGCTCTAAGTGCGTTTTTTCTGC
GTAAACCTACGATGACGTAGAAGATTGCTCATAGCTTGAATGATAGATGGCAACATTGGAGTGATCAAAAGGTTT
GCATTTGCACCTAAGAAGGGGCTCAGCGTGCTCACCATTATAATAGCATGATGGCAGAGTTGACCGATTCGACAA
ACATTGCCCAAGTAAGCGGCACCTCCTTTTCGATTTCGGTATGCTGATTGTGCCAGGCTTATGCATACATGCCGA
TAGCATGGTCAACCGGTGGAACTGTGAGTAGTGCTCGTGGACATCTTTCTTATCGGCATGTGACTTATAAGTTTT
GTAGTTAGGTCCAATTATTGGAGGATCCCTCTCACATCCAGCAGAACGATTCCCTTCCCTATTCGGGAACAGTGA
ATTCCTCAAAAAATACCCTTACTTTTTGCCTTGTGCAGTTCCGGCCACGTACACCGTCTGCGCCTGGCTTATTAC
TTATATCTTCTTGAAAGAGACAGTTCAGCGTCCGACATCTTTCCGAAACCTTATTTTTGGATCTGATAAAAAGCT
CAAGCTTGAACAAAATCAAGTTGCGACCGTTGACGATAGCGATGACAAACCTCTTCCTTTACGATCTCTGTTGGT
GTTTCGAGTCATCATCGCTGCAAGCAATTACGCTTTCCTTTCTTTGGTCGACATTGCTTTCCGTGCAATTCAACC
GGTGTTCCTTTCGACTCCTATTGAATTGGGTGGACTGGGACTTCCTCCTTCCACGATTGGAAATATTTTATCCGT
GTATGGGGTTCTCAATGGTTTCATCCAGATCTTTTTCTTCGCCAAAATGCACGATCGCTGGGGCTCGAAAAAGGT
TTTTACAGCCGGCATTGCCGCGTGTATCCCTATGTTTCTTCTCTTCCCCATCATCAACTATTTAGCACGTTCGCA
AGGATTGACCCCATTGGTATGGGGCTTTGTATCTCTACAGGTCGGCTTGGCTATGATGCCAAGCTTGTCGTTCAG
TGCGTGCTTTTGCTTTGCTGCTGTTAACTCCCGTTGATAATTACTTCTGAACCAGGCTCCATTTTCATTTTTATC
ACAGCAGCGTCCCCTAACAAGGCTTCTCTTGGCGCTACCAATGGATTGTGTCAGGTGGGTAACTCTATCTGACTG
AGACGCAGCAGGAGTAATGAGTCATTTATTCTGTTATAGGTGGCTGTCAGTGTGATGCGGGCATTCGGCCCTGCA
GCGGCGAATTCGTTGTTTTCGCTGTCGATGGCATATAACTTGTTGGGTGGATATCTCGTCTATTACATACTTGTT
GTAATTGTTGGTATTGCGCTTTTTGTAGCGTCTATTTTGCCGAGCTCTGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail