Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080280
Gene name
Locationscaffold_5:554918..558177
Strand+
Gene length (bp)3259
Transcript length (bp)2607
Coding sequence length (bp)2607
Protein length (aa) 869

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 7.1E-70 424 754
PF00449 Urease_alpha Urease alpha-subunit, N-terminal domain 1.2E-56 299 418
PF00699 Urease_beta Urease beta subunit 1.1E-41 169 264
PF00547 Urease_gamma Urease, gamma subunit 2.5E-39 31 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CS22|UREA_CRYNJ Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=URE1 PE=3 SV=1 31 868 0.0E+00
sp|P0CS23|UREA_CRYNB Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=URE1 PE=3 SV=1 31 868 0.0E+00
sp|O13465|UREA_CRYNH Urease OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=URE1 PE=3 SV=3 31 868 0.0E+00
sp|Q6A3P9|UREA_ASPFU Urease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ure1 PE=2 SV=2 31 868 0.0E+00
sp|Q9SR52|UREA_ARATH Urease OS=Arabidopsis thaliana GN=URE PE=3 SV=1 31 868 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CS22|UREA_CRYNJ Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=URE1 PE=3 SV=1 31 868 0.0E+00
sp|P0CS23|UREA_CRYNB Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=URE1 PE=3 SV=1 31 868 0.0E+00
sp|O13465|UREA_CRYNH Urease OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=URE1 PE=3 SV=3 31 868 0.0E+00
sp|Q6A3P9|UREA_ASPFU Urease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ure1 PE=2 SV=2 31 868 0.0E+00
sp|Q9SR52|UREA_ARATH Urease OS=Arabidopsis thaliana GN=URE PE=3 SV=1 31 868 0.0E+00
sp|B9GCH9|UREA_ORYSJ Urease OS=Oryza sativa subsp. japonica GN=Os12g0234800 PE=3 SV=2 31 868 0.0E+00
sp|E0ZS48|UREA_ORYSI Urease OS=Oryza sativa subsp. indica PE=1 SV=1 31 868 0.0E+00
sp|P07374|UREA_CANEN Urease OS=Canavalia ensiformis PE=1 SV=3 31 868 0.0E+00
sp|O00084|UREA_SCHPO Urease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ure1 PE=1 SV=1 33 868 0.0E+00
sp|A0L6F2|URE1_MAGMM Urease subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|Q11VN3|URE1_CYTH3 Urease subunit alpha OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q2JQ88|URE1_SYNJB Urease subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A7HHN1|URE1_ANADF Urease subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B4RSX9|URE1_ALTMD Urease subunit alpha OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q3KIT2|URE1_PSEPF Urease subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B4UFU2|URE1_ANASK Urease subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|Q4ZN06|URE12_PSEU2 Urease subunit alpha 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureC2 PE=3 SV=1 299 868 0.0E+00
sp|Q4KJ10|URE1_PSEF5 Urease subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A6SZ07|URE1_JANMA Urease subunit alpha OS=Janthinobacterium sp. (strain Marseille) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q1GJP8|URE1_RUEST Urease subunit alpha OS=Ruegeria sp. (strain TM1040) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q48DE6|URE1_PSE14 Urease subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q87VP0|URE1_PSESM Urease subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B8HW50|URE1_CYAP4 Urease subunit alpha OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B0JKA1|URE1_MICAN Urease subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=ureC PE=3 SV=1 297 868 0.0E+00
sp|Q161S8|URE1_ROSDO Urease subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|C5BUN9|URE1_TERTT Urease subunit alpha OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q07K73|URE1_RHOP5 Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1U4Z8|URE1_MARHV Urease subunit alpha OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A9GP84|URE1_SORC5 Urease subunit alpha OS=Sorangium cellulosum (strain So ce56) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|Q3M712|URE1_ANAVT Urease subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q3J154|URE1_RHOS4 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B9KK46|URE1_RHOSK Urease subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|A3PL38|URE1_RHOS1 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B2IT66|URE1_NOSP7 Urease subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8XXT1|URE1_RALSO Urease subunit alpha OS=Ralstonia solanacearum (strain GMI1000) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q9KG59|URE1_BACHD Urease subunit alpha OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8YQZ0|URE1_NOSS1 Urease subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1SYY1|URE1_PSYIN Urease subunit alpha OS=Psychromonas ingrahamii (strain 37) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q63RL3|URE1_BURPS Urease subunit alpha OS=Burkholderia pseudomallei (strain K96243) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P73061|URE1_SYNY3 Urease subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A4WR75|URE1_RHOS5 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A3NCL7|URE1_BURP6 Urease subunit alpha OS=Burkholderia pseudomallei (strain 668) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B1YUF9|URE1_BURA4 Urease subunit alpha OS=Burkholderia ambifaria (strain MC40-6) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A5GWV7|URE1_SYNR3 Urease subunit alpha OS=Synechococcus sp. (strain RCC307) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A3NYC9|URE1_BURP0 Urease subunit alpha OS=Burkholderia pseudomallei (strain 1106a) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q0BHN5|URE1_BURCM Urease subunit alpha OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|C4LF63|URE1_TOLAT Urease subunit alpha OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B8EPU9|URE1_METSB Urease subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q3JPJ6|URE1_BURP1 Urease subunit alpha OS=Burkholderia pseudomallei (strain 1710b) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|A1V1G6|URE1_BURMS Urease subunit alpha OS=Burkholderia mallei (strain SAVP1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q62HS0|URE1_BURMA Urease subunit alpha OS=Burkholderia mallei (strain ATCC 23344) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A2S996|URE1_BURM9 Urease subunit alpha OS=Burkholderia mallei (strain NCTC 10229) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A3MMV2|URE1_BURM7 Urease subunit alpha OS=Burkholderia mallei (strain NCTC 10247) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q1QCE0|URE11_PSYCK Urease subunit alpha 1 OS=Psychrobacter cryohalolentis (strain K5) GN=ureC1 PE=3 SV=1 299 868 0.0E+00
sp|Q2SDQ1|URE1_HAHCH Urease subunit alpha OS=Hahella chejuensis (strain KCTC 2396) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q3IH68|URE1_PSEHT Urease subunit alpha OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q9HUU5|URE1_PSEAE Urease subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A4JC42|URE1_BURVG Urease subunit alpha OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B4ECC7|URE1_BURCJ Urease subunit alpha OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A0K576|URE1_BURCH Urease subunit alpha OS=Burkholderia cenocepacia (strain HI2424) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B1JX29|URE1_BURCC Urease subunit alpha OS=Burkholderia cenocepacia (strain MC0-3) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q1BYH2|URE1_BURCA Urease subunit alpha OS=Burkholderia cenocepacia (strain AU 1054) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5LSQ2|URE1_RUEPO Urease subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q2SYF7|URE1_BURTA Urease subunit alpha OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q39IW3|URE1_BURL3 Urease subunit alpha OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A9BUC4|URE1_DELAS Urease subunit alpha OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q210F9|URE1_RHOPB Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q89UG0|URE1_BRADU Urease subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureC PE=3 SV=1 295 868 0.0E+00
sp|Q3J770|URE1_NITOC Urease subunit alpha OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A8LRS0|URE1_DINSH Urease subunit alpha OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q11EW4|URE1_CHESB Urease subunit alpha OS=Chelativorans sp. (strain BNC1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q07397|URE1_BACSB Urease subunit alpha OS=Bacillus sp. (strain TB-90) GN=ureC PE=1 SV=1 300 868 0.0E+00
sp|Q47G55|URE1_DECAR Urease subunit alpha OS=Dechloromonas aromatica (strain RCB) GN=ureC PE=3 SV=1 295 868 0.0E+00
sp|A9AF72|URE1_BURM1 Urease subunit alpha OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q473Q9|URE1_CUPPJ Urease subunit alpha OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q6N3N3|URE1_RHOPA Urease subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A3DGF8|URE1_CLOTH Urease subunit alpha OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B3QGK1|URE1_RHOPT Urease subunit alpha OS=Rhodopseudomonas palustris (strain TIE-1) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q0I656|URE1_SYNS3 Urease subunit alpha OS=Synechococcus sp. (strain CC9311) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q98CY9|URE1_RHILO Urease subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q0KCP6|URE1_CUPNH Urease subunit alpha OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A6UC35|URE1_SINMW Urease subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q133L6|URE1_RHOPS Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A2BQW8|URE1_PROMS Urease subunit alpha OS=Prochlorococcus marinus (strain AS9601) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A9AZE6|URE1_HERA2 Urease subunit alpha OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q492E9|URE1_BLOPB Urease subunit alpha OS=Blochmannia pennsylvanicus (strain BPEN) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|O87402|URE1_SYNPV Urease subunit alpha OS=Synechococcus sp. (strain WH7805) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|C3MGI5|URE1_RHISN Urease subunit alpha OS=Rhizobium sp. (strain NGR234) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q1H0F2|URE1_METFK Urease subunit alpha OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A6VTV8|URE1_MARMS Urease subunit alpha OS=Marinomonas sp. (strain MWYL1) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|P42885|URE1_RHIME Urease subunit alpha OS=Rhizobium meliloti (strain 1021) GN=ureC PE=3 SV=2 299 868 0.0E+00
sp|Q3AGD0|URE1_SYNSC Urease subunit alpha OS=Synechococcus sp. (strain CC9605) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A8G4K9|URE1_PROM2 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9215) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q3AVR1|URE1_SYNS9 Urease subunit alpha OS=Synechococcus sp. (strain CC9902) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2IZ49|URE1_RHOP2 Urease subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A4SY44|URE1_POLSQ Urease subunit alpha OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B9J8M3|URE1_AGRRK Urease subunit alpha OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B3PXB3|URE1_RHIE6 Urease subunit alpha OS=Rhizobium etli (strain CIAT 652) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A3PCP1|URE1_PROM0 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9301) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A5FAD1|URE1_FLAJ1 Urease subunit alpha OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8DMV6|URE1_THEEB Urease subunit alpha OS=Thermosynechococcus elongatus (strain BP-1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8G2P8|URE11_BRUSU Urease subunit alpha 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureC1 PE=1 SV=1 299 868 0.0E+00
sp|Q93T81|URE11_BRUAB Urease subunit alpha 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureC1 PE=3 SV=1 299 868 0.0E+00
sp|Q2YPD5|URE11_BRUA2 Urease subunit alpha 1 OS=Brucella abortus (strain 2308) GN=ureC1 PE=1 SV=1 299 868 0.0E+00
sp|Q21P94|URE1_SACD2 Urease subunit alpha OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A5UH45|URE1_HAEIG Urease subunit alpha OS=Haemophilus influenzae (strain PittGG) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|A5U9V6|URE1_HAEIE Urease subunit alpha OS=Haemophilus influenzae (strain PittEE) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q4QN09|URE1_HAEI8 Urease subunit alpha OS=Haemophilus influenzae (strain 86-028NP) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q117Z3|URE1_TRIEI Urease subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2K517|URE1_RHIEC Urease subunit alpha OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A2C4S2|URE1_PROM1 Urease subunit alpha OS=Prochlorococcus marinus (strain NATL1A) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B5ZMP0|URE1_RHILW Urease subunit alpha OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q6FD83|URE1_ACIAD Urease subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q7U3I3|URE1_SYNPX Urease subunit alpha OS=Synechococcus sp. (strain WH8102) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q7V3V2|URE1_PROMM Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9313) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P44391|URE1_HAEIN Urease subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|A3N2R4|URE1_ACTP2 Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B3H2L3|URE1_ACTP7 Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B6YQL8|URE1_AZOPC Urease subunit alpha OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8UCT2|URE1_AGRFC Urease subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8YF72|URE11_BRUME Urease subunit alpha 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureC1 PE=3 SV=1 299 868 0.0E+00
sp|Q5E728|URE1_VIBF1 Urease subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q46IY3|URE1_PROMT Urease subunit alpha OS=Prochlorococcus marinus (strain NATL2A) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B0BRU2|URE1_ACTPJ Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B9JR81|URE1_AGRVS Urease subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q28RJ3|URE1_JANSC Urease subunit alpha OS=Jannaschia sp. (strain CCS1) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q5KYM1|URE1_GEOKA Urease subunit alpha OS=Geobacillus kaustophilus (strain HTA426) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q0VKY1|URE1_ALCBS Urease subunit alpha OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q31B49|URE1_PROM9 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9312) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q1MCV9|URE1_RHIL3 Urease subunit alpha OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A2CE01|URE1_PROM3 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9303) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B5FBC6|URE1_VIBFM Urease subunit alpha OS=Vibrio fischeri (strain MJ11) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B5YUX3|URE1_ECO5E Urease subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q8XAG0|URE1_ECO57 Urease subunit alpha OS=Escherichia coli O157:H7 GN=ureC1 PE=3 SV=1 298 868 0.0E+00
sp|Q9RYJ4|URE1_DEIRA Urease subunit alpha OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|O54420|URE1_ACTPL Urease subunit alpha OS=Actinobacillus pleuropneumoniae GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q08716|URE1_HELFC Urease subunit beta OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ureB PE=1 SV=2 299 868 0.0E+00
sp|Q9L644|URE1_PROS9 Urease subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain PCC 9511) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|Q7V1B6|URE1_PROMP Urease subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q733J6|URE1_BACC1 Urease subunit alpha OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1B1B9|URE1_PARDP Urease subunit alpha OS=Paracoccus denitrificans (strain Pd 1222) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B1Y3V1|URE1_LEPCP Urease subunit alpha OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|P77837|URE1_BACSU Urease subunit alpha OS=Bacillus subtilis (strain 168) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|A7Z9N4|URE1_BACMF Urease subunit alpha OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1TSZ6|URE1_ACIAC Urease subunit alpha OS=Acidovorax citrulli (strain AAC00-1) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q5FB23|URE1_CAMLA Urease subunit beta OS=Campylobacter lari GN=ureB PE=3 SV=1 299 865 0.0E+00
sp|Q93PJ4|URE1_HELHP Urease subunit beta OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureB PE=2 SV=1 299 868 0.0E+00
sp|P42823|URE1_HELHE Urease subunit beta OS=Helicobacter heilmannii GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|A9KJR9|URE1_CLOPH Urease subunit alpha OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|Q7VUD3|URE1_BORPE Urease subunit alpha OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|P17086|URE1_PROMH Urease subunit alpha OS=Proteus mirabilis (strain HI4320) GN=ureC PE=1 SV=2 300 868 0.0E+00
sp|O08400|URE1_BORBR Urease subunit alpha OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ureC PE=3 SV=2 298 868 0.0E+00
sp|P16122|URE1_PROHU Urease subunit alpha OS=Proteus hauseri GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|A1VKW3|URE1_POLNA Urease subunit alpha OS=Polaromonas naphthalenivorans (strain CJ2) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q7W417|URE1_BORPA Urease subunit alpha OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q1QC36|URE12_PSYCK Urease subunit alpha 2 OS=Psychrobacter cryohalolentis (strain K5) GN=ureC2 PE=3 SV=2 286 868 0.0E+00
sp|A1KBB4|URE1_AZOSB Urease subunit alpha OS=Azoarcus sp. (strain BH72) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B1ZP06|URE1_OPITP Urease subunit alpha OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q8FQX2|URE1_COREF Urease subunit alpha OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A2SDJ0|URE1_METPP Urease subunit alpha OS=Methylibium petroleiphilum (strain PM1) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B2UW70|URE1_HELPS Urease subunit beta OS=Helicobacter pylori (strain Shi470) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|B5Z674|URE1_HELPG Urease subunit beta OS=Helicobacter pylori (strain G27) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|B6JPH5|URE1_HELP2 Urease subunit beta OS=Helicobacter pylori (strain P12) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|A1WIM3|URE1_VEREI Urease subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|P69996|URE1_HELPY Urease subunit beta OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureB PE=1 SV=1 299 868 0.0E+00
sp|P69997|URE1_HELPJ Urease subunit beta OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|B1J815|URE1_PSEPW Urease subunit alpha OS=Pseudomonas putida (strain W619) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q1IBP0|URE1_PSEE4 Urease subunit alpha OS=Pseudomonas entomophila (strain L48) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A6TE42|URE1_KLEP7 Urease subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|P18314|URE1_ENTAE Urease subunit alpha OS=Enterobacter aerogenes GN=ureC PE=1 SV=1 298 868 0.0E+00
sp|Q1CV82|URE1_HELPH Urease subunit beta OS=Helicobacter pylori (strain HPAG1) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|A8APV0|URE1_CITK8 Urease subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|B5XU27|URE1_KLEP3 Urease subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q2Y9M7|URE1_NITMU Urease subunit alpha OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q7VRS6|URE1_BLOFL Urease subunit alpha OS=Blochmannia floridanus GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B0KUZ7|URE1_PSEPG Urease subunit alpha OS=Pseudomonas putida (strain GB-1) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|P41020|URE1_SPOPA Urease subunit alpha OS=Sporosarcina pasteurii GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|Q12DU3|URE1_POLSJ Urease subunit alpha OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B2IIJ1|URE1_BEII9 Urease subunit alpha OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|C5CY00|URE1_VARPS Urease subunit alpha OS=Variovorax paradoxus (strain S110) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|Q88J04|URE1_PSEPK Urease subunit alpha OS=Pseudomonas putida (strain KT2440) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A4WEJ5|URE1_ENT38 Urease subunit alpha OS=Enterobacter sp. (strain 638) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A5W4B6|URE1_PSEP1 Urease subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A0JRH4|URE1_ARTS2 Urease subunit alpha OS=Arthrobacter sp. (strain FB24) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A4XMA9|URE1_CALS8 Urease subunit alpha OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B7K912|URE1_CYAP7 Urease subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B8HA07|URE1_ARTCA Urease subunit alpha OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q826R9|URE12_STRAW Urease subunit alpha 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureC2 PE=3 SV=1 299 868 0.0E+00
sp|Q2JWP0|URE1_SYNJA Urease subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q21SZ2|URE1_RHOFT Urease subunit alpha OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ureC PE=3 SV=1 300 868 0.0E+00
sp|B0TT71|URE1_SHEHH Urease subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1T9N4|URE1_MYCVP Urease subunit alpha OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q0RQS0|URE1_FRAAA Urease subunit alpha OS=Frankia alni (strain ACN14a) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A1R1C5|URE1_ARTAT Urease subunit alpha OS=Arthrobacter aurescens (strain TC1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A8ESZ8|URE1_ARCB4 Urease subunit beta OS=Arcobacter butzleri (strain RM4018) GN=ureB PE=3 SV=1 299 868 0.0E+00
sp|Q8CNC9|URE1_STAES Urease subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5HLW1|URE1_STAEQ Urease subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q4A0J5|URE1_STAS1 Urease subunit alpha OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureC PE=1 SV=3 299 868 0.0E+00
sp|Q79VJ3|URE1_CORGL Urease subunit alpha OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|P67405|URE1_STAAW Urease subunit alpha OS=Staphylococcus aureus (strain MW2) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A8Z387|URE1_STAAT Urease subunit alpha OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q6G732|URE1_STAAS Urease subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P67404|URE1_STAAN Urease subunit alpha OS=Staphylococcus aureus (strain N315) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|P67403|URE1_STAAM Urease subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A6QJD0|URE1_STAAE Urease subunit alpha OS=Staphylococcus aureus (strain Newman) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5HDR8|URE1_STAAC Urease subunit alpha OS=Staphylococcus aureus (strain COL) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2G2K5|URE1_STAA8 Urease subunit alpha OS=Staphylococcus aureus (strain NCTC 8325) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2FEK3|URE1_STAA3 Urease subunit alpha OS=Staphylococcus aureus (strain USA300) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A7X5M3|URE1_STAA1 Urease subunit alpha OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q1B872|URE1_MYCSS Urease subunit alpha OS=Mycobacterium sp. (strain MCS) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A1UGT5|URE1_MYCSK Urease subunit alpha OS=Mycobacterium sp. (strain KMS) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A3Q0D5|URE1_MYCSJ Urease subunit alpha OS=Mycobacterium sp. (strain JLS) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|A5IV71|URE1_STAA9 Urease subunit alpha OS=Staphylococcus aureus (strain JH9) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A6U414|URE1_STAA2 Urease subunit alpha OS=Staphylococcus aureus (strain JH1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q6GEE4|URE1_STAAR Urease subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2YYQ6|URE1_STAAB Urease subunit alpha OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q2JES6|URE1_FRASC Urease subunit alpha OS=Frankia sp. (strain CcI3) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q9FCD3|URE11_STRCO Urease subunit alpha 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureC1 PE=3 SV=1 299 868 0.0E+00
sp|B2GI06|URE1_KOCRD Urease subunit alpha OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P9WFF1|URE1_MYCTU Urease subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ureC PE=1 SV=1 299 868 0.0E+00
sp|P9WFF0|URE1_MYCTO Urease subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A5U3L7|URE1_MYCTA Urease subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|C1APC7|URE1_MYCBT Urease subunit alpha OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A1KJR2|URE1_MYCBP Urease subunit alpha OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P0A661|URE1_MYCBO Urease subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5YWR8|URE1_NOCFA Urease subunit alpha OS=Nocardia farcinica (strain IFM 10152) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|P42873|URE1_STAXY Urease subunit alpha OS=Staphylococcus xylosus GN=ureC PE=1 SV=3 299 868 0.0E+00
sp|C5C8U3|URE1_MICLC Urease subunit alpha OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A8L7B0|URE1_FRASN Urease subunit alpha OS=Frankia sp. (strain EAN1pec) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|B9DLY0|URE1_STACT Urease subunit alpha OS=Staphylococcus carnosus (strain TM300) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|B2HSZ2|URE1_MYCMM Urease subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q03ME3|URE1_STRTD Urease subunit alpha OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5M607|URE1_STRT2 Urease subunit alpha OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q5M1G6|URE1_STRT1 Urease subunit alpha OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|P50047|URE1_STRE5 Urease subunit alpha OS=Streptococcus salivarius (strain 57.I) GN=ureC PE=1 SV=3 299 868 0.0E+00
sp|A0PSG2|URE1_MYCUA Urease subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|A0QYE0|URE1_MYCS2 Urease subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|B1MB85|URE1_MYCA9 Urease subunit alpha OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q7N4Y7|URE1_PHOLL Urease subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ureC PE=3 SV=1 300 865 0.0E+00
sp|Q8FZW2|URE12_BRUSU Urease subunit alpha 2 OS=Brucella suis biovar 1 (strain 1330) GN=ureC2 PE=3 SV=1 298 865 0.0E+00
sp|B1VHT2|URE1_CORU7 Urease subunit alpha OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ureC PE=3 SV=1 299 868 0.0E+00
sp|Q0S4S7|URE1_RHOJR Urease subunit alpha OS=Rhodococcus jostii (strain RHA1) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q8YHZ8|URE12_BRUME Urease subunit alpha 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureC2 PE=3 SV=1 298 865 0.0E+00
sp|C5BBR6|URE1_EDWI9 Urease subunit alpha OS=Edwardsiella ictaluri (strain 93-146) GN=ureC PE=3 SV=1 300 865 0.0E+00
sp|P26929|URE1_LACFE Urease subunit alpha OS=Lactobacillus fermentum GN=ureC PE=3 SV=1 302 868 0.0E+00
sp|C1AXZ2|URE1_RHOOB Urease subunit alpha OS=Rhodococcus opacus (strain B4) GN=ureC PE=3 SV=1 298 868 0.0E+00
sp|Q57CE8|URE12_BRUAB Urease subunit alpha 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureC2 PE=3 SV=1 298 865 0.0E+00
sp|Q2YQD8|URE12_BRUA2 Urease subunit alpha 2 OS=Brucella abortus (strain 2308) GN=ureC2 PE=3 SV=1 298 865 0.0E+00
sp|P94669|URE1_CLOPF Urease subunit alpha OS=Clostridium perfringens GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|C1D5Z8|URE1_LARHH Urease subunit alpha OS=Laribacter hongkongensis (strain HLHK9) GN=ureC PE=3 SV=1 298 865 0.0E+00
sp|P31494|URE1_YEREN Urease subunit alpha OS=Yersinia enterocolitica GN=ureC PE=3 SV=3 299 865 0.0E+00
sp|A1JKD9|URE1_YERE8 Urease subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|B1JR71|URE1_YERPY Urease subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|P52313|URE1_YERPS Urease subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ureC PE=3 SV=3 299 865 0.0E+00
sp|A4TL32|URE1_YERPP Urease subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|Q1CKJ9|URE1_YERPN Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|A9R3V0|URE1_YERPG Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|Q9ZFR9|URE1_YERPE Urease subunit alpha OS=Yersinia pestis GN=ureC PE=3 SV=3 299 865 0.0E+00
sp|B2KAA4|URE1_YERPB Urease subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|Q1C5B3|URE1_YERPA Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|A7FFN2|URE1_YERP3 Urease subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ureC PE=3 SV=1 299 865 0.0E+00
sp|P0CB00|URE1_UREUR Urease subunit alpha OS=Ureaplasma urealyticum GN=ureC PE=1 SV=1 299 847 0.0E+00
sp|B5ZBS9|URE1_UREU1 Urease subunit alpha OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ureC PE=3 SV=1 299 847 0.0E+00
sp|P0C7K7|URE1_UREPA Urease subunit alpha OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ureC PE=3 SV=1 299 847 0.0E+00
sp|B1AJ73|URE1_UREP2 Urease subunit alpha OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ureC PE=3 SV=1 299 847 0.0E+00
sp|Q3IRZ5|URE1_NATPD Urease subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ureC PE=3 SV=1 302 867 0.0E+00
sp|Q4ZUD2|URE11_PSEU2 Urease subunit alpha 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureC1 PE=3 SV=1 302 867 0.0E+00
sp|Q972W0|URE1_SULTO Urease subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ureC PE=3 SV=2 299 868 0.0E+00
sp|Q18EB9|URE1_HALWD Urease subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ureC PE=3 SV=1 299 867 0.0E+00
sp|Q75ZQ5|URE1_HALMA Urease subunit alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ureC PE=3 SV=1 300 867 0.0E+00
sp|Q82JN9|URE11_STRAW Urease subunit alpha 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureC1 PE=3 SV=1 305 867 1.0E-151
sp|O86508|URE12_STRCO Urease subunit alpha 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureC2 PE=3 SV=1 305 867 1.0E-148
sp|P50045|URE1_HELMU Urease subunit beta (Fragment) OS=Helicobacter mustelae GN=ureB PE=3 SV=1 299 605 3.0E-121
sp|Q08715|URE23_HELFE Urease subunit alpha OS=Helicobacter felis GN=ureA PE=3 SV=1 31 261 3.0E-61
sp|Q8GH98|URE23_HELBI Urease subunit alpha OS=Helicobacter bizzozeronii GN=ureA PE=3 SV=1 31 261 3.0E-59
sp|P42822|URE23_HELHE Urease subunit alpha OS=Helicobacter heilmannii GN=ureA PE=3 SV=1 31 261 6.0E-59
sp|Q93PJ5|URE23_HELHP Urease subunit alpha OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureA PE=3 SV=1 31 285 2.0E-58
sp|P50046|URE1_PHODD Urease subunit alpha (Fragment) OS=Photobacterium damselae subsp. damselae GN=ureC PE=3 SV=1 390 544 2.0E-58
sp|Q17VS7|URE23_HELAH Urease subunit alpha OS=Helicobacter acinonychis (strain Sheeba) GN=ureA PE=3 SV=1 31 283 2.0E-57
sp|P50044|URE23_HELMU Urease subunit alpha (Fragment) OS=Helicobacter mustelae GN=ureA PE=3 SV=1 43 266 3.0E-56
sp|P14916|URE23_HELPY Urease subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureA PE=1 SV=2 31 283 5.0E-56
sp|Q1CV81|URE23_HELPH Urease subunit alpha OS=Helicobacter pylori (strain HPAG1) GN=ureA PE=3 SV=1 31 283 5.0E-56
sp|B6JPH6|URE23_HELP2 Urease subunit alpha OS=Helicobacter pylori (strain P12) GN=ureA PE=3 SV=1 31 283 5.0E-56
sp|Q9ZMZ4|URE23_HELPJ Urease subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureA PE=3 SV=1 31 283 6.0E-56
sp|B2UW71|URE23_HELPS Urease subunit alpha OS=Helicobacter pylori (strain Shi470) GN=ureA PE=3 SV=1 31 283 2.0E-55
sp|Q9RYJ3|URE23_DEIRA Urease subunit gamma/beta OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureAB PE=3 SV=1 31 266 4.0E-48
sp|Q5FB24|URE23_CAMLA Urease subunit alpha OS=Campylobacter lari GN=ureA PE=3 SV=1 31 266 8.0E-47
sp|Q883F3|URE23_PSESM Urease subunit gamma/beta OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureAB PE=3 SV=1 31 266 6.0E-46
sp|Q4ZUD1|URE23_PSEU2 Urease subunit gamma/beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureAB PE=3 SV=1 31 266 6.0E-45
sp|Q972V9|URE23_SULTO Urease subunit gamma/beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ureAB PE=3 SV=2 31 266 6.0E-44
sp|P08298|UREA_SOYBN Urease (Fragment) OS=Glycine max PE=3 SV=1 669 795 3.0E-39
sp|Q46IY4|URE2_PROMT Urease subunit beta OS=Prochlorococcus marinus (strain NATL2A) GN=ureB PE=3 SV=1 169 261 1.0E-29
sp|A2C4S1|URE2_PROM1 Urease subunit beta OS=Prochlorococcus marinus (strain NATL1A) GN=ureB PE=3 SV=1 169 261 1.0E-29
sp|B5ZMP3|URE2_RHILW Urease subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ureB PE=3 SV=1 169 266 3.0E-29
sp|Q8G2P9|URE21_BRUSU Urease subunit beta 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureB1 PE=1 SV=1 169 266 3.0E-29
sp|Q7CNT2|URE21_BRUME Urease subunit beta 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureB1 PE=3 SV=1 169 266 3.0E-29
sp|P0C1D5|URE21_BRUAB Urease subunit beta 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureB1 PE=3 SV=1 169 266 3.0E-29
sp|Q2YPD6|URE21_BRUA2 Urease subunit beta 1 OS=Brucella abortus (strain 2308) GN=ureB1 PE=1 SV=1 169 266 3.0E-29
sp|Q31B50|URE2_PROM9 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=ureB PE=3 SV=1 169 268 3.0E-29
sp|Q1H0F1|URE2_METFK Urease subunit beta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ureB PE=3 SV=1 177 257 6.0E-29
sp|A3DGF9|URE2_CLOTH Urease subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ureB PE=3 SV=1 169 264 7.0E-29
sp|Q9KG60|URE2_BACHD Urease subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureB PE=3 SV=1 169 266 7.0E-29
sp|Q8FZW3|URE22_BRUSU Urease subunit beta 2 OS=Brucella suis biovar 1 (strain 1330) GN=ureB2 PE=3 SV=1 155 267 9.0E-29
sp|Q8YHZ7|URE22_BRUME Urease subunit beta 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureB2 PE=3 SV=1 155 267 9.0E-29
sp|Q57CE9|URE22_BRUAB Urease subunit beta 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureB2 PE=3 SV=1 155 267 9.0E-29
sp|Q2YQD9|URE22_BRUA2 Urease subunit beta 2 OS=Brucella abortus (strain 2308) GN=ureB2 PE=3 SV=1 155 267 9.0E-29
sp|Q2K514|URE2_RHIEC Urease subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ureB PE=3 SV=1 169 266 1.0E-28
sp|A3PCP0|URE2_PROM0 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=ureB PE=3 SV=1 169 268 1.0E-28
sp|Q161T1|URE2_ROSDO Urease subunit beta OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ureB PE=3 SV=1 169 266 1.0E-28
sp|Q5LSQ3|URE2_RUEPO Urease subunit beta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ureB PE=3 SV=1 169 266 1.0E-28
sp|Q1MCV6|URE2_RHIL3 Urease subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ureB PE=3 SV=1 169 266 1.0E-28
sp|Q11EW5|URE2_CHESB Urease subunit beta OS=Chelativorans sp. (strain BNC1) GN=ureB PE=3 SV=1 169 257 2.0E-28
sp|B3PXB6|URE2_RHIE6 Urease subunit beta OS=Rhizobium etli (strain CIAT 652) GN=ureB PE=3 SV=1 169 266 2.0E-28
sp|Q4A0J4|URE2_STAS1 Urease subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureB PE=1 SV=1 169 277 2.0E-28
sp|Q21P95|URE2_SACD2 Urease subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ureB PE=3 SV=1 177 276 2.0E-28
sp|A8G4K8|URE2_PROM2 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=ureB PE=3 SV=1 160 266 3.0E-28
sp|Q98CY6|URE2_RHILO Urease subunit beta OS=Rhizobium loti (strain MAFF303099) GN=ureB PE=3 SV=1 169 266 9.0E-28
sp|B8EPV0|URE2_METSB Urease subunit beta OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureB PE=3 SV=1 169 266 9.0E-28
sp|B2IT65|URE2_NOSP7 Urease subunit beta OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ureB PE=3 SV=1 169 266 1.0E-27
sp|Q7V3V3|URE2_PROMM Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9313) GN=ureB PE=3 SV=1 163 264 1.0E-27
sp|B8HW51|URE2_CYAP4 Urease subunit beta OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ureB PE=3 SV=1 169 266 1.0E-27
sp|A5ERV2|URE2_BRASB Urease subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ureB PE=3 SV=1 169 257 1.0E-27
sp|Q18EC0|URE2_HALWD Urease subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ureB PE=3 SV=1 167 266 1.0E-27
sp|A2BQW7|URE2_PROMS Urease subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=ureB PE=3 SV=1 169 268 1.0E-27
sp|Q75ZQ6|URE2_HALMA Urease subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ureB PE=3 SV=1 169 266 2.0E-27
sp|Q2IZ51|URE2_RHOP2 Urease subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=ureB PE=3 SV=1 169 257 2.0E-27
sp|P74386|URE2_SYNY3 Urease subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureB PE=3 SV=1 169 264 2.0E-27
sp|Q07398|URE2_BACSB Urease subunit beta OS=Bacillus sp. (strain TB-90) GN=ureB PE=1 SV=1 169 266 2.0E-27
sp|Q89UG2|URE2_BRADU Urease subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureB PE=3 SV=1 169 257 2.0E-27
sp|A0L6F1|URE2_MAGMM Urease subunit beta OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureB PE=3 SV=1 169 266 2.0E-27
sp|A1U4Z9|URE2_MARHV Urease subunit beta OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ureB PE=3 SV=1 174 274 2.0E-27
sp|A9KJS0|URE2_CLOPH Urease subunit beta OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureB PE=3 SV=1 169 271 3.0E-27
sp|Q133L3|URE2_RHOPS Urease subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=ureB PE=3 SV=1 169 257 3.0E-27
sp|A2CE00|URE2_PROM3 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9303) GN=ureB PE=3 SV=1 163 264 3.0E-27
sp|Q1LPT0|URE2_CUPMC Urease subunit beta OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ureB PE=3 SV=1 169 266 3.0E-27
sp|A4YM26|URE2_BRASO Urease subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=ureB PE=3 SV=1 169 257 3.0E-27
sp|P42874|URE2_STAXY Urease subunit beta OS=Staphylococcus xylosus GN=ureB PE=1 SV=1 169 270 4.0E-27
sp|B0C793|URE2_ACAM1 Urease subunit beta OS=Acaryochloris marina (strain MBIC 11017) GN=ureB PE=3 SV=1 169 266 4.0E-27
sp|B9J8M5|URE2_AGRRK Urease subunit beta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ureB PE=3 SV=1 169 257 4.0E-27
sp|B0BRU3|URE2_ACTPJ Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureB PE=3 SV=1 177 266 4.0E-27
sp|A3N2R5|URE2_ACTP2 Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureB PE=3 SV=1 177 266 4.0E-27
sp|Q0KCP7|URE2_CUPNH Urease subunit beta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureB PE=3 SV=1 169 259 4.0E-27
sp|Q47G54|URE2_DECAR Urease subunit beta OS=Dechloromonas aromatica (strain RCB) GN=ureB PE=3 SV=1 169 266 5.0E-27
sp|C4LF64|URE2_TOLAT Urease subunit beta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureB PE=3 SV=1 177 291 5.0E-27
sp|B3R401|URE2_CUPTR Urease subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ureB PE=3 SV=1 169 259 6.0E-27
sp|B3QGK3|URE2_RHOPT Urease subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=ureB PE=3 SV=1 169 257 9.0E-27
sp|Q6N3N1|URE2_RHOPA Urease subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureB PE=3 SV=1 169 257 9.0E-27
sp|Q3IRZ6|URE2_NATPD Urease subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ureB PE=3 SV=1 167 266 1.0E-26
sp|A9AZE7|URE2_HERA2 Urease subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ureB PE=3 SV=1 176 293 1.0E-26
sp|Q3J151|URE2_RHOS4 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ureB PE=3 SV=1 169 266 1.0E-26
sp|A3PL41|URE2_RHOS1 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ureB PE=3 SV=1 169 266 1.0E-26
sp|Q8CND0|URE2_STAES Urease subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureB PE=3 SV=1 169 270 1.0E-26
sp|Q5HLW2|URE2_STAEQ Urease subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureB PE=3 SV=1 169 270 1.0E-26
sp|Q117Z8|URE2_TRIEI Urease subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=ureB PE=3 SV=1 169 263 1.0E-26
sp|Q4KJ09|URE2_PSEF5 Urease subunit beta OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ureB PE=3 SV=1 177 257 1.0E-26
sp|Q8YQZ2|URE2_NOSS1 Urease subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ureB PE=3 SV=1 169 266 1.0E-26
sp|O54419|URE2_ACTPL Urease subunit beta OS=Actinobacillus pleuropneumoniae GN=ureB PE=3 SV=1 177 266 2.0E-26
sp|B3H2L4|URE2_ACTP7 Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureB PE=3 SV=1 177 266 2.0E-26
sp|Q1GJP7|URE2_RUEST Urease subunit beta OS=Ruegeria sp. (strain TM1040) GN=ureB PE=3 SV=1 169 260 2.0E-26
sp|A4QA22|URE2_CORGB Urease subunit beta OS=Corynebacterium glutamicum (strain R) GN=ureB PE=3 SV=1 169 303 2.0E-26
sp|A8LRS3|URE2_DINSH Urease subunit beta OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ureB PE=3 SV=1 169 259 3.0E-26
sp|B9KK50|URE2_RHOSK Urease subunit beta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ureB PE=3 SV=1 169 266 3.0E-26
sp|Q7V1B5|URE2_PROMP Urease subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ureB PE=3 SV=1 169 264 3.0E-26
sp|A4WR73|URE2_RHOS5 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ureB PE=3 SV=1 169 266 3.0E-26
sp|B2JF66|URE2_BURP8 Urease subunit beta OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ureB PE=3 SV=1 169 266 4.0E-26
sp|Q39IW2|URE2_BURL3 Urease subunit beta OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ureB PE=3 SV=1 169 257 4.0E-26
sp|B9JR84|URE2_AGRVS Urease subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ureB PE=3 SV=1 169 257 5.0E-26
sp|B0JTP2|URE2_MICAN Urease subunit beta OS=Microcystis aeruginosa (strain NIES-843) GN=ureB PE=3 SV=1 169 266 5.0E-26
sp|Q79VJ4|URE2_CORGL Urease subunit beta OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureB PE=1 SV=1 169 303 5.0E-26
sp|Q8DLZ6|URE2_THEEB Urease subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=ureB PE=3 SV=1 169 257 5.0E-26
sp|P44392|URE2_HAEIN Urease subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureB PE=3 SV=1 177 266 5.0E-26
sp|A5U9V5|URE2_HAEIE Urease subunit beta OS=Haemophilus influenzae (strain PittEE) GN=ureB PE=3 SV=1 177 266 5.0E-26
sp|Q4QN08|URE2_HAEI8 Urease subunit beta OS=Haemophilus influenzae (strain 86-028NP) GN=ureB PE=3 SV=1 177 266 5.0E-26
sp|Q473R0|URE2_CUPPJ Urease subunit beta OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ureB PE=3 SV=1 169 259 6.0E-26
sp|Q7N4Y8|URE2_PHOLL Urease subunit beta OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ureB PE=3 SV=1 169 285 6.0E-26
sp|B8HA06|URE2_ARTCA Urease subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ureB PE=3 SV=1 169 266 6.0E-26
sp|Q07K71|URE2_RHOP5 Urease subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=ureB PE=3 SV=1 169 257 8.0E-26
sp|B2U7N2|URE2_RALPJ Urease subunit beta OS=Ralstonia pickettii (strain 12J) GN=ureB PE=3 SV=1 169 257 8.0E-26
sp|Q3M710|URE2_ANAVT Urease subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureB PE=3 SV=1 169 266 8.0E-26
sp|Q7U3I4|URE2_SYNPX Urease subunit beta OS=Synechococcus sp. (strain WH8102) GN=ureB PE=3 SV=1 169 266 9.0E-26
sp|Q210F6|URE2_RHOPB Urease subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=ureB PE=3 SV=1 169 274 9.0E-26
sp|B2GI07|URE2_KOCRD Urease subunit beta OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureB PE=3 SV=1 167 266 1.0E-25
sp|A5GWV6|URE2_SYNR3 Urease subunit beta OS=Synechococcus sp. (strain RCC307) GN=ureB PE=3 SV=1 169 266 1.0E-25
sp|Q9FCD2|URE2_STRCO Urease subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureB PE=3 SV=1 169 257 1.0E-25
sp|O87401|URE2_SYNPV Urease subunit beta OS=Synechococcus sp. (strain WH7805) GN=ureB PE=1 SV=1 169 266 2.0E-25
sp|Q2Y9M8|URE2_NITMU Urease subunit beta OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ureB PE=3 SV=1 169 266 2.0E-25
sp|Q02FF4|URE3_PSEAB Urease subunit gamma OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ureA PE=3 SV=1 31 131 2.0E-25
sp|A6VCX2|URE3_PSEA7 Urease subunit gamma OS=Pseudomonas aeruginosa (strain PA7) GN=ureA PE=3 SV=1 31 131 2.0E-25
sp|Q8XXT0|URE2_RALSO Urease subunit beta OS=Ralstonia solanacearum (strain GMI1000) GN=ureB PE=3 SV=1 169 257 2.0E-25
sp|Q9HUU8|URE3_PSEAE Urease subunit gamma OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureA PE=3 SV=1 31 131 2.0E-25
sp|B7V1S8|URE3_PSEA8 Urease subunit gamma OS=Pseudomonas aeruginosa (strain LESB58) GN=ureA PE=3 SV=1 31 131 2.0E-25
sp|P42886|URE2_RHIME Urease subunit beta OS=Rhizobium meliloti (strain 1021) GN=ureB PE=3 SV=1 169 257 2.0E-25
sp|P69991|URE2_YERPS Urease subunit beta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ureB PE=3 SV=1 169 267 2.0E-25
sp|P69990|URE2_YERPE Urease subunit beta OS=Yersinia pestis GN=ureB PE=3 SV=1 169 267 2.0E-25
sp|A7FFN1|URE2_YERP3 Urease subunit beta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ureB PE=3 SV=1 169 267 2.0E-25
sp|C5C8U2|URE2_MICLC Urease subunit beta OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=ureB PE=3 SV=1 178 266 2.0E-25
sp|A3DGG0|URE3_CLOTH Urease subunit gamma OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ureA PE=3 SV=1 31 130 3.0E-25
sp|A9AF71|URE2_BURM1 Urease subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ureB PE=3 SV=1 169 257 3.0E-25
sp|Q28RJ8|URE2_JANSC Urease subunit beta OS=Jannaschia sp. (strain CCS1) GN=ureB PE=3 SV=1 169 266 3.0E-25
sp|C5BUP0|URE2_TERTT Urease subunit beta OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ureB PE=3 SV=1 174 276 4.0E-25
sp|Q89UG3|URE3_BRADU Urease subunit gamma OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureA PE=3 SV=1 31 130 4.0E-25
sp|A0K577|URE2_BURCH Urease subunit beta OS=Burkholderia cenocepacia (strain HI2424) GN=ureB PE=3 SV=1 169 257 4.0E-25
sp|Q1BYH1|URE2_BURCA Urease subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=ureB PE=3 SV=1 169 257 4.0E-25
sp|A1R1C4|URE2_ARTAT Urease subunit beta OS=Arthrobacter aurescens (strain TC1) GN=ureB PE=3 SV=1 178 266 6.0E-25
sp|Q0AC99|URE2_ALKEH Urease subunit beta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ureB PE=3 SV=1 169 257 6.0E-25
sp|B1Y3V2|URE2_LEPCP Urease subunit beta OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ureB PE=3 SV=1 167 266 7.0E-25
sp|A5FAD2|URE2_FLAJ1 Urease subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ureB PE=3 SV=1 177 264 7.0E-25
sp|Q5KYM0|URE2_GEOKA Urease subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=ureB PE=3 SV=1 174 264 7.0E-25
sp|C3MGX4|URE2_RHISN Urease subunit beta OS=Rhizobium sp. (strain NGR234) GN=ureB PE=3 SV=1 169 257 8.0E-25
sp|B1JX30|URE2_BURCC Urease subunit beta OS=Burkholderia cenocepacia (strain MC0-3) GN=ureB PE=3 SV=1 169 257 8.0E-25
sp|Q12DU2|URE2_POLSJ Urease subunit beta OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ureB PE=3 SV=1 167 264 1.0E-24
sp|A6SZ06|URE2_JANMA Urease subunit beta OS=Janthinobacterium sp. (strain Marseille) GN=ureB PE=3 SV=1 169 266 1.0E-24
sp|A6VCX4|URE2_PSEA7 Urease subunit beta OS=Pseudomonas aeruginosa (strain PA7) GN=ureB PE=3 SV=1 177 257 1.0E-24
sp|A6UC38|URE2_SINMW Urease subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=ureB PE=3 SV=1 169 257 1.0E-24
sp|Q9HUU6|URE2_PSEAE Urease subunit beta OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureB PE=3 SV=1 177 257 1.0E-24
sp|Q02FF2|URE2_PSEAB Urease subunit beta OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ureB PE=3 SV=1 177 257 1.0E-24
sp|B7V1T0|URE2_PSEA8 Urease subunit beta OS=Pseudomonas aeruginosa (strain LESB58) GN=ureB PE=3 SV=1 177 257 1.0E-24
sp|A4VQU9|URE3_PSEU5 Urease subunit gamma OS=Pseudomonas stutzeri (strain A1501) GN=ureA PE=3 SV=1 31 131 1.0E-24
sp|C3K5A2|URE2_PSEFS Urease subunit beta OS=Pseudomonas fluorescens (strain SBW25) GN=ureB PE=3 SV=1 177 257 1.0E-24
sp|Q8UCS8|URE2_AGRFC Urease subunit beta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ureB PE=3 SV=1 169 257 1.0E-24
sp|A1JKD8|URE2_YERE8 Urease subunit beta OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ureB PE=3 SV=1 169 267 1.0E-24
sp|B0TT70|URE2_SHEHH Urease subunit beta OS=Shewanella halifaxensis (strain HAW-EB4) GN=ureB PE=3 SV=1 177 266 2.0E-24
sp|A4VQV0|URE2_PSEU5 Urease subunit beta OS=Pseudomonas stutzeri (strain A1501) GN=ureB PE=3 SV=1 177 257 2.0E-24
sp|P31495|URE2_YEREN Urease subunit beta OS=Yersinia enterocolitica GN=ureB PE=1 SV=4 169 267 2.0E-24
sp|O86507|URE23_STRCO Urease subunit gamma/beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureAB PE=3 SV=1 31 266 2.0E-24
sp|B0VSC1|URE2_ACIBS Urease subunit beta OS=Acinetobacter baumannii (strain SDF) GN=ureB PE=3 SV=1 169 257 2.0E-24
sp|Q2SYF6|URE2_BURTA Urease subunit beta OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureB PE=3 SV=1 180 257 2.0E-24
sp|Q0BHN4|URE2_BURCM Urease subunit beta OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ureB PE=3 SV=1 169 257 2.0E-24
sp|A1VKW4|URE2_POLNA Urease subunit beta OS=Polaromonas naphthalenivorans (strain CJ2) GN=ureB PE=3 SV=1 169 266 2.0E-24
sp|A6VTV7|URE2_MARMS Urease subunit beta OS=Marinomonas sp. (strain MWYL1) GN=ureB PE=3 SV=1 178 274 2.0E-24
sp|Q3KIS8|URE3_PSEPF Urease subunit gamma OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureA PE=3 SV=1 31 131 3.0E-24
sp|B9DLX9|URE2_STACT Urease subunit beta OS=Staphylococcus carnosus (strain TM300) GN=ureB PE=3 SV=1 169 270 3.0E-24
sp|A4JC43|URE2_BURVG Urease subunit beta OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ureB PE=3 SV=1 169 257 3.0E-24
sp|B4ECC6|URE2_BURCJ Urease subunit beta OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ureB PE=3 SV=1 169 257 3.0E-24
sp|B2HVR9|URE2_ACIBC Urease subunit beta OS=Acinetobacter baumannii (strain ACICU) GN=ureB PE=3 SV=1 169 257 3.0E-24
sp|A7Z9N5|URE2_BACMF Urease subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ureB PE=3 SV=1 169 280 3.0E-24
sp|A2SDJ1|URE2_METPP Urease subunit beta OS=Methylibium petroleiphilum (strain PM1) GN=ureB PE=3 SV=1 167 266 3.0E-24
sp|A3M3F1|URE2_ACIBT Urease subunit beta OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ureB PE=3 SV=2 169 257 3.0E-24
sp|B1YUG0|URE2_BURA4 Urease subunit beta OS=Burkholderia ambifaria (strain MC40-6) GN=ureB PE=3 SV=1 169 257 3.0E-24
sp|Q144E3|URE2_BURXL Urease subunit beta OS=Burkholderia xenovorans (strain LB400) GN=ureB PE=3 SV=1 180 266 4.0E-24
sp|Q63RL4|URE2_BURPS Urease subunit beta OS=Burkholderia pseudomallei (strain K96243) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|Q3JPJ7|URE2_BURP1 Urease subunit beta OS=Burkholderia pseudomallei (strain 1710b) GN=ureB PE=3 SV=2 169 257 4.0E-24
sp|A3NYC8|URE2_BURP0 Urease subunit beta OS=Burkholderia pseudomallei (strain 1106a) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|A1V1G7|URE2_BURMS Urease subunit beta OS=Burkholderia mallei (strain SAVP1) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|Q62HS1|URE2_BURMA Urease subunit beta OS=Burkholderia mallei (strain ATCC 23344) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|A2S997|URE2_BURM9 Urease subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|A3MMV1|URE2_BURM7 Urease subunit beta OS=Burkholderia mallei (strain NCTC 10247) GN=ureB PE=3 SV=1 169 257 4.0E-24
sp|Q2SDQ2|URE2_HAHCH Urease subunit beta OS=Hahella chejuensis (strain KCTC 2396) GN=ureB PE=3 SV=1 177 257 4.0E-24
sp|Q3AGD1|URE2_SYNSC Urease subunit beta OS=Synechococcus sp. (strain CC9605) GN=ureB PE=3 SV=1 169 266 4.0E-24
sp|B2T0P6|URE2_BURPP Urease subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ureB PE=3 SV=1 180 266 5.0E-24
sp|Q3KIT1|URE2_PSEPF Urease subunit beta OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureB PE=3 SV=1 177 257 5.0E-24
sp|Q3J769|URE2_NITOC Urease subunit beta OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ureB PE=3 SV=1 177 259 5.0E-24
sp|A4XQ47|URE3_PSEMY Urease subunit gamma OS=Pseudomonas mendocina (strain ymp) GN=ureA PE=3 SV=1 31 131 6.0E-24
sp|Q1QV52|URE2_CHRSD Urease subunit beta OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ureB PE=3 SV=1 177 257 6.0E-24
sp|Q4ZN07|URE2_PSEU2 Urease subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureB PE=3 SV=1 177 257 6.0E-24
sp|A3NCL6|URE2_BURP6 Urease subunit beta OS=Burkholderia pseudomallei (strain 668) GN=ureB PE=3 SV=1 169 257 7.0E-24
sp|B0V9P6|URE2_ACIBY Urease subunit beta OS=Acinetobacter baumannii (strain AYE) GN=ureB PE=3 SV=1 169 257 7.0E-24
sp|B7I8T4|URE2_ACIB5 Urease subunit beta OS=Acinetobacter baumannii (strain AB0057) GN=ureB PE=3 SV=1 169 257 7.0E-24
sp|B7GXU4|URE2_ACIB3 Urease subunit beta OS=Acinetobacter baumannii (strain AB307-0294) GN=ureB PE=3 SV=1 169 257 7.0E-24
sp|Q48DE7|URE2_PSE14 Urease subunit beta OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ureB PE=3 SV=1 177 257 7.0E-24
sp|Q1QCE1|URE2_PSYCK Urease subunit beta OS=Psychrobacter cryohalolentis (strain K5) GN=ureB PE=3 SV=1 174 274 8.0E-24
sp|Q3AVR2|URE2_SYNS9 Urease subunit beta OS=Synechococcus sp. (strain CC9902) GN=ureB PE=3 SV=1 169 266 8.0E-24
sp|Q6FD84|URE2_ACIAD Urease subunit beta OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ureB PE=3 SV=1 169 257 8.0E-24
sp|Q87VP4|URE3_PSESM Urease subunit gamma OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureA PE=3 SV=1 31 131 9.0E-24
sp|Q0VKY0|URE2_ALCBS Urease subunit beta OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ureB PE=3 SV=1 177 257 1.0E-23
sp|B0KUZ8|URE2_PSEPG Urease subunit beta OS=Pseudomonas putida (strain GB-1) GN=ureB PE=3 SV=1 177 257 1.0E-23
sp|C3K5A5|URE3_PSEFS Urease subunit gamma OS=Pseudomonas fluorescens (strain SBW25) GN=ureA PE=3 SV=1 31 131 1.0E-23
sp|C1DNK6|URE3_AZOVD Urease subunit gamma OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ureA PE=3 SV=1 31 131 1.0E-23
sp|Q3IH69|URE2_PSEHT Urease subunit beta OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ureB PE=3 SV=1 174 274 1.0E-23
sp|Q733J5|URE2_BACC1 Urease subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureB PE=3 SV=1 169 269 1.0E-23
sp|Q88J05|URE2_PSEPK Urease subunit beta OS=Pseudomonas putida (strain KT2440) GN=ureB PE=3 SV=1 177 257 1.0E-23
sp|B8GQ25|URE2_THISH Urease subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ureB PE=3 SV=1 177 268 1.0E-23
sp|P0CB01|URE2_UREUR Urease subunit beta OS=Ureaplasma urealyticum GN=ureB PE=1 SV=1 160 266 2.0E-23
sp|B5ZBT0|URE2_UREU1 Urease subunit beta OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ureB PE=3 SV=1 160 266 2.0E-23
sp|Q2YYQ7|URE2_STAAB Urease subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q8NV90|URE2_STAAW Urease subunit beta OS=Staphylococcus aureus (strain MW2) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|A8Z386|URE2_STAAT Urease subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q6G733|URE2_STAAS Urease subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q5HDR9|URE2_STAAC Urease subunit beta OS=Staphylococcus aureus (strain COL) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q2G2K6|URE2_STAA8 Urease subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q2FEK4|URE2_STAA3 Urease subunit beta OS=Staphylococcus aureus (strain USA300) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|Q826S1|URE3_STRAW Urease subunit gamma OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureA PE=3 SV=1 31 131 2.0E-23
sp|A6QJC9|URE2_STAAE Urease subunit beta OS=Staphylococcus aureus (strain Newman) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|P67407|URE2_STAAN Urease subunit beta OS=Staphylococcus aureus (strain N315) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|P67406|URE2_STAAM Urease subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|A5IV70|URE2_STAA9 Urease subunit beta OS=Staphylococcus aureus (strain JH9) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|A6U413|URE2_STAA2 Urease subunit beta OS=Staphylococcus aureus (strain JH1) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|A7X5M0|URE2_STAA1 Urease subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|C5CXZ9|URE2_VARPS Urease subunit beta OS=Variovorax paradoxus (strain S110) GN=ureB PE=3 SV=1 169 266 2.0E-23
sp|B1J814|URE2_PSEPW Urease subunit beta OS=Pseudomonas putida (strain W619) GN=ureB PE=3 SV=1 177 257 2.0E-23
sp|Q6GEE5|URE2_STAAR Urease subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=ureB PE=3 SV=1 169 270 2.0E-23
sp|P41021|URE2_SPOPA Urease subunit beta OS=Sporosarcina pasteurii GN=ureB PE=1 SV=1 177 266 2.0E-23
sp|A1KBB5|URE2_AZOSB Urease subunit beta OS=Azoarcus sp. (strain BH72) GN=ureB PE=3 SV=1 169 259 2.0E-23
sp|Q02943|URE3_KLEPN Urease subunit gamma OS=Klebsiella pneumoniae GN=ureA PE=3 SV=1 31 131 2.0E-23
sp|C4LF65|URE3_TOLAT Urease subunit gamma OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureA PE=3 SV=1 31 131 2.0E-23
sp|Q210F5|URE3_RHOPB Urease subunit gamma OS=Rhodopseudomonas palustris (strain BisB18) GN=ureA PE=3 SV=1 31 130 2.0E-23
sp|Q07K70|URE3_RHOP5 Urease subunit gamma OS=Rhodopseudomonas palustris (strain BisA53) GN=ureA PE=3 SV=1 31 130 3.0E-23
sp|P0C7K8|URE2_UREPA Urease subunit beta OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ureB PE=3 SV=1 160 266 3.0E-23
sp|B1AJ74|URE2_UREP2 Urease subunit beta OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ureB PE=3 SV=1 160 266 3.0E-23
sp|Q5YWR9|URE2_NOCFA Urease subunit beta OS=Nocardia farcinica (strain IFM 10152) GN=ureB PE=3 SV=1 178 257 3.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0035550 urease complex Yes
GO:0016787 hydrolase activity Yes
GO:0043419 urea catabolic process Yes
GO:0016151 nickel cation binding Yes
GO:0043603 cellular amide metabolic process No
GO:0019627 urea metabolic process No
GO:0009056 catabolic process No
GO:0043605 cellular amide catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0044281 small molecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0071941 nitrogen cycle metabolic process No
GO:1901575 organic substance catabolic process No
GO:1902494 catalytic complex No
GO:0044282 small molecule catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080280
MEDRSSVTAHTLLVGKSAKFQQADMEALLVMRLLPREEAKVLLHQVGFIAQKRLARGVKLNRTEAVALIASVLQE
RIRDGRHSVAELMQHGKKILGRRHVLPDVPALLHEIQVEGTFLDGVFLVTVHQPICTEDGDLEAALYGSFLPIPP
QDDFPVAPDSDYLPEKTAGAIIPKQEDIVLNQGRERIRLRITNTGDRPIQVGSHYHFIETNRALSFDRLKSYGKR
LDIAAGTAVRFEPGDTKAVTLVSISGNKVISGGNSLASGHIGTFRSEVLLEDILRRDFAHVAEPGALEVMEDTKI
GRETYISMYGPTVGDRVRLGDTELWIEVEHDETVYGDEVKFGGGKVIREGMGQATNRSSNETLDLVITNALIVDW
SGIYKADIGVKNGFICGIGKAGNPDVMSNIHPTLVIGSSTEVIAGEKLIITAGGIDTHIHFICPQLVDEALASGL
TTLIGGGTGPSAGTNATTCTPSPFYMRHMLAATDGLPMNFGFTGKGNDAGPTAIEEIVRAGALGLKLHEDWGTTP
AAIRNCLDVADKYDVQVTIHTDTLNESGFVESTIEAFGGRTIHTYHTEGAGGGHAPDIIVVCGQNNVLPSSTNPT
RPYAKNTLDEHLDMLMVCHHLDKSIPEDLDFAESRIRAETVAAEDVLHDIGAISMISSDSQAMGRIGEVISRTWR
TASKMREVRGPLTDLGDDGRKDNARVKRYIAKYTVNPAIAHGISHLVGHVAVGTLADLVLWKPENFGSKPEMILK
AGVITYSQVGDANASIPSVQPFYSKPMWGAKPGSAALNSVAFVSQVSITSRVIESYGLSKKIEAVRGCRDIGKKD
MKWNDTTPSMKVDPESYEVRADGVLMDVKPAERVALATPYNLF*
Coding >AgabiH97|080280
ATGGAAGACAGGTCATCGGTGACCGCACACACCCTTTTGGTTGGGAAATCAGCGAAGTTTCAACAAGCCGACATG
GAAGCGCTACTGGTCATGCGTCTCCTCCCGCGCGAAGAGGCCAAAGTCCTCCTCCACCAGGTTGGATTTATTGCG
CAAAAGCGACTTGCAAGAGGTGTCAAGCTGAATAGGACAGAGGCTGTGGCCTTGATTGCTTCGGTTCTTCAAGAG
CGAATACGAGATGGTCGGCATTCTGTCGCGGAATTGATGCAGCACGGGAAAAAGATACTTGGGCGAAGGCATGTG
CTACCAGATGTTCCAGCGCTGTTACATGAAATTCAAGTTGAGGGTACTTTTCTCGATGGAGTTTTTTTGGTGACG
GTGCACCAACCCATCTGTACTGAAGACGGCGATCTCGAAGCTGCACTCTATGGCTCTTTCCTCCCCATACCTCCA
CAAGACGATTTCCCAGTGGCTCCCGACTCGGATTACCTCCCGGAGAAGACCGCGGGGGCAATCATACCCAAACAA
GAGGATATCGTTTTAAATCAGGGTCGAGAGAGAATCCGTCTTCGGATAACTAATACGGGCGATAGACCTATTCAA
GTTGGCTCACACTACCACTTTATTGAAACCAATCGCGCTCTTTCATTTGATAGGCTGAAATCTTATGGAAAGAGG
CTAGATATCGCTGCTGGAACTGCTGTACGATTCGAACCCGGAGACACCAAGGCTGTCACTCTCGTGTCTATTTCT
GGAAATAAAGTCATTTCGGGTGGAAATAGTTTGGCTTCTGGACACATAGGAACGTTCCGAAGTGAAGTTCTTCTA
GAGGACATCCTGCGAAGAGACTTTGCACATGTCGCCGAACCGGGTGCTCTCGAGGTGATGGAGGATACGAAGATT
GGAAGGGAGACGTATATTTCGATGTACGGCCCGACTGTGGGTGATAGAGTAAGGCTAGGCGATACTGAGTTGTGG
ATTGAAGTCGAACATGACGAGACCGTGTATGGCGACGAAGTCAAATTTGGGGGAGGCAAGGTCATCCGAGAGGGC
ATGGGTCAGGCTACAAATCGTTCATCGAACGAAACTCTTGACCTTGTAATCACCAACGCACTCATTGTAGACTGG
TCGGGAATTTACAAGGCAGATATTGGTGTTAAGAACGGTTTCATATGCGGCATCGGAAAGGCAGGAAATCCCGAT
GTGATGTCAAACATCCATCCCACTCTCGTCATTGGATCATCTACAGAAGTCATCGCCGGAGAAAAGCTCATTATC
ACGGCAGGTGGAATCGATACCCACATACACTTTATCTGTCCGCAATTGGTTGACGAAGCTCTGGCATCTGGTTTG
ACTACATTGATTGGAGGTGGAACTGGTCCTAGCGCTGGAACAAATGCGACGACGTGTACGCCAAGTCCTTTCTAC
ATGCGACATATGTTAGCGGCTACAGACGGTTTGCCAATGAACTTTGGTTTTACGGGTAAAGGAAATGATGCTGGC
CCGACGGCAATTGAGGAGATCGTACGTGCGGGTGCATTAGGTTTGAAGTTGCATGAGGATTGGGGTACAACGCCA
GCCGCTATCAGGAATTGTTTGGACGTTGCAGATAAGTATGACGTTCAGGTCACAATTCATACCGACACTCTCAAC
GAGAGTGGTTTTGTTGAGAGTACCATCGAGGCCTTTGGCGGGCGAACAATCCATACTTACCACACCGAGGGCGCA
GGCGGAGGCCACGCACCTGATATCATTGTGGTTTGTGGCCAAAACAACGTTTTGCCATCATCAACCAATCCCACT
CGTCCGTATGCCAAGAATACGCTTGATGAACACCTCGACATGCTTATGGTATGTCATCACCTCGATAAATCAATT
CCGGAGGACCTCGATTTTGCGGAGTCGCGTATCAGGGCGGAGACAGTTGCTGCAGAAGATGTTTTGCACGATATC
GGTGCGATTTCAATGATAAGCTCCGATTCTCAGGCTATGGGCCGTATTGGAGAGGTGATTAGTCGGACATGGAGG
ACTGCGAGTAAGATGAGGGAAGTCCGAGGACCTTTGACAGATCTCGGCGATGATGGTCGGAAAGATAATGCCAGA
GTCAAACGTTATATTGCCAAGTATACTGTCAATCCTGCTATCGCCCATGGCATCAGTCACCTCGTCGGTCACGTC
GCAGTAGGCACACTCGCAGATCTTGTTCTCTGGAAACCTGAAAACTTCGGCTCAAAACCGGAAATGATTCTCAAG
GCTGGCGTAATAACATATTCCCAGGTCGGAGACGCGAATGCATCGATACCCTCTGTTCAACCATTTTACTCTAAA
CCCATGTGGGGAGCGAAACCAGGTTCGGCAGCACTTAATTCTGTGGCTTTCGTCTCGCAAGTTTCGATTACGTCG
AGGGTGATTGAATCGTATGGATTGTCAAAGAAGATTGAAGCTGTCAGAGGGTGTAGGGATATTGGTAAGAAGGAT
ATGAAGTGGAATGATACGACCCCTTCGATGAAGGTGGACCCGGAGAGTTATGAGGTCCGTGCTGATGGTGTACTA
ATGGATGTAAAGCCTGCAGAGAGGGTAGCTTTGGCGACACCGTATAATCTATTCTAG
Transcript >AgabiH97|080280
ATGGAAGACAGGTCATCGGTGACCGCACACACCCTTTTGGTTGGGAAATCAGCGAAGTTTCAACAAGCCGACATG
GAAGCGCTACTGGTCATGCGTCTCCTCCCGCGCGAAGAGGCCAAAGTCCTCCTCCACCAGGTTGGATTTATTGCG
CAAAAGCGACTTGCAAGAGGTGTCAAGCTGAATAGGACAGAGGCTGTGGCCTTGATTGCTTCGGTTCTTCAAGAG
CGAATACGAGATGGTCGGCATTCTGTCGCGGAATTGATGCAGCACGGGAAAAAGATACTTGGGCGAAGGCATGTG
CTACCAGATGTTCCAGCGCTGTTACATGAAATTCAAGTTGAGGGTACTTTTCTCGATGGAGTTTTTTTGGTGACG
GTGCACCAACCCATCTGTACTGAAGACGGCGATCTCGAAGCTGCACTCTATGGCTCTTTCCTCCCCATACCTCCA
CAAGACGATTTCCCAGTGGCTCCCGACTCGGATTACCTCCCGGAGAAGACCGCGGGGGCAATCATACCCAAACAA
GAGGATATCGTTTTAAATCAGGGTCGAGAGAGAATCCGTCTTCGGATAACTAATACGGGCGATAGACCTATTCAA
GTTGGCTCACACTACCACTTTATTGAAACCAATCGCGCTCTTTCATTTGATAGGCTGAAATCTTATGGAAAGAGG
CTAGATATCGCTGCTGGAACTGCTGTACGATTCGAACCCGGAGACACCAAGGCTGTCACTCTCGTGTCTATTTCT
GGAAATAAAGTCATTTCGGGTGGAAATAGTTTGGCTTCTGGACACATAGGAACGTTCCGAAGTGAAGTTCTTCTA
GAGGACATCCTGCGAAGAGACTTTGCACATGTCGCCGAACCGGGTGCTCTCGAGGTGATGGAGGATACGAAGATT
GGAAGGGAGACGTATATTTCGATGTACGGCCCGACTGTGGGTGATAGAGTAAGGCTAGGCGATACTGAGTTGTGG
ATTGAAGTCGAACATGACGAGACCGTGTATGGCGACGAAGTCAAATTTGGGGGAGGCAAGGTCATCCGAGAGGGC
ATGGGTCAGGCTACAAATCGTTCATCGAACGAAACTCTTGACCTTGTAATCACCAACGCACTCATTGTAGACTGG
TCGGGAATTTACAAGGCAGATATTGGTGTTAAGAACGGTTTCATATGCGGCATCGGAAAGGCAGGAAATCCCGAT
GTGATGTCAAACATCCATCCCACTCTCGTCATTGGATCATCTACAGAAGTCATCGCCGGAGAAAAGCTCATTATC
ACGGCAGGTGGAATCGATACCCACATACACTTTATCTGTCCGCAATTGGTTGACGAAGCTCTGGCATCTGGTTTG
ACTACATTGATTGGAGGTGGAACTGGTCCTAGCGCTGGAACAAATGCGACGACGTGTACGCCAAGTCCTTTCTAC
ATGCGACATATGTTAGCGGCTACAGACGGTTTGCCAATGAACTTTGGTTTTACGGGTAAAGGAAATGATGCTGGC
CCGACGGCAATTGAGGAGATCGTACGTGCGGGTGCATTAGGTTTGAAGTTGCATGAGGATTGGGGTACAACGCCA
GCCGCTATCAGGAATTGTTTGGACGTTGCAGATAAGTATGACGTTCAGGTCACAATTCATACCGACACTCTCAAC
GAGAGTGGTTTTGTTGAGAGTACCATCGAGGCCTTTGGCGGGCGAACAATCCATACTTACCACACCGAGGGCGCA
GGCGGAGGCCACGCACCTGATATCATTGTGGTTTGTGGCCAAAACAACGTTTTGCCATCATCAACCAATCCCACT
CGTCCGTATGCCAAGAATACGCTTGATGAACACCTCGACATGCTTATGGTATGTCATCACCTCGATAAATCAATT
CCGGAGGACCTCGATTTTGCGGAGTCGCGTATCAGGGCGGAGACAGTTGCTGCAGAAGATGTTTTGCACGATATC
GGTGCGATTTCAATGATAAGCTCCGATTCTCAGGCTATGGGCCGTATTGGAGAGGTGATTAGTCGGACATGGAGG
ACTGCGAGTAAGATGAGGGAAGTCCGAGGACCTTTGACAGATCTCGGCGATGATGGTCGGAAAGATAATGCCAGA
GTCAAACGTTATATTGCCAAGTATACTGTCAATCCTGCTATCGCCCATGGCATCAGTCACCTCGTCGGTCACGTC
GCAGTAGGCACACTCGCAGATCTTGTTCTCTGGAAACCTGAAAACTTCGGCTCAAAACCGGAAATGATTCTCAAG
GCTGGCGTAATAACATATTCCCAGGTCGGAGACGCGAATGCATCGATACCCTCTGTTCAACCATTTTACTCTAAA
CCCATGTGGGGAGCGAAACCAGGTTCGGCAGCACTTAATTCTGTGGCTTTCGTCTCGCAAGTTTCGATTACGTCG
AGGGTGATTGAATCGTATGGATTGTCAAAGAAGATTGAAGCTGTCAGAGGGTGTAGGGATATTGGTAAGAAGGAT
ATGAAGTGGAATGATACGACCCCTTCGATGAAGGTGGACCCGGAGAGTTATGAGGTCCGTGCTGATGGTGTACTA
ATGGATGTAAAGCCTGCAGAGAGGGTAGCTTTGGCGACACCGTATAATCTATTCTAG
Gene >AgabiH97|080280
ATGGAAGACAGGTCATCGGTGACCGCACACACCCTTTTGGTTGGGAAATCAGCGAAGGTGAGCTCAGGGAAAACT
TTCCTAGTTTCGTCCTTATCTCTCGGCAAGTCTGGCGGGTGTTCTTATCTTATCTTTATATTCAAGTTTCAACAA
GCCGACATGGAAGCGCTACTGTTCCTCTGTTTGCTGCTACCAGTTGTCTCAGACCCATTTTCATACTCCTGAAAG
AAAATAGAAAAGGGTCATGCGTCTCCTCCCGCGCGAAGAGGCCAAAGTCCTCCTCCACCAGGTGAGCTTCCTTAT
CTGTGCCCGAGATAAGGAACAATGACACTAAAACTGTCTCAACTCAGGTTGGATTTATTGCGCAAAAGCGACTTG
CAAGAGGTGTCAAGCTGAATAGGACAGAGGCTGTGGCCTTGATTGCTTCGGTTCTTCAAGAGCGAATACGAGATG
GTCGGCATTCTGTCGCGGAATTGATGCAGCACGGGAAAAAGATACTTGGGCGAAGGCATGTGCTACCAGATGTTC
CAGCGCTGTTACATGAAATTCAAGTTGAGGGTACTTTTCTCGATGGGTGCGCCTCCTTGCCTCCGCTCCGTCAAT
CCATTCTTAGTGCCGGCTCATTTTTGTTCTACCCTGTGACAGAGTTTTTTTGGTGACGGTGCACCAACCCATCTG
TACTGAAGACGGCGATCTCGAAGCTGCACTCTATGGCTCTTTCCTCCCCATACCTCCACAAGACGATTTCCCAGT
GGCTCCCGACTCGGATTACCTCCCGGAGAAGACCGCGGGGGCAATCATACCCAAACAAGAGGATATCGTTTTAAA
TCAGGGTCGAGAGAGAATCCGTCTTCGGATAACTAATACGGGCGATAGACCTATTCAAGTTGGCTCACACTACCA
CTTTATTGAAACCAATCGCGCTCTTTCATTTGATAGGCTGAAATCTTATGGAAAGAGGCTAGATATCGCTGCTGG
AACTGCTGTACGATTCGAACCCGGAGACACCAAGGCTGTCACTCTCGTGTCTATTTCTGGAAATAAAGTCATTTC
GGGTGGAAATAGTTTGGCTTCTGGACACATAGGAACGTTCCGAAGTGAAGTTCTTCTAGAGGACATCCTGCGAAG
AGACTTTGCACATGTCGCCGAACCGGGTGCTCTCGAGGTGATGGAGGATACGAAGATTGGAAGGGAGACGTATAT
TTCGATGTACGGCCCGACTGTGGGTGATAGAGTAAGGCTAGGCGATACTGAGTTGTGGATTGAAGTCGAACATGA
CGAGGTGAGGTTTGTCCGCTAGTCGTGTAACATGTTATTAACGTATTTTAGACCGTGTATGGCGACGAAGTCAAA
TTTGGGGGAGGTAGGAGGTCTTCGACGTTTCCTGTGCAGTTCTCACTTGTATTACAGGCAAGGTCATCCGAGAGG
GCATGGGTCAGGCTACAAATCGTTCATCGAACGAAACTCTTGACCTTGTAATCACCAACGCACTCATTGTAGACT
GGTCGGGAATTTACAAGGTAAGCCTTTTAGTTTAAGGTCCTACAGTATGGATTGGTGAGCTCGATACAGGCAGAT
ATTGGTGTTAAGAACGGTTTCATATGCGGCATCGGAAAGGCAGGAAATCCCGATGTGATGTCAAACATCCATCCC
ACTCTCGTCATTGGATCATCTACAGAAGTCATCGCCGGAGAAAAGCTCATTATCACGGCAGGTGGAATCGATACC
CACATACACTTTATCTGTCCGCAATTGGTTGACGAAGCTCTGGCATCTGGTTTGACTACATTGATTGGAGGTGGA
ACTGGTCCTAGCGCTGGAACAAATGCGACGACGTGTACGCCAAGTCCTTTCTACATGCGACATATGTTAGCGGCT
ACAGACGGTTTGCCAATGAACTTTGGTTTTACGGGTAAAGGAAATGATGCTGGCCCGACGGCAATTGAGGAGATC
GTACGTGCGGGTGCATTAGGTTTGAAGTTGCATGAGGATTGGGGTACAACGCCAGCCGCTATCAGGAATTGTTTG
GACGTTGCAGATAAGTATGACGTTCAGGTATTCAGCTCTTTACTGGATTTCCATTGGGGCGTTATAATAACAAAT
GTCTTCTAGGTCACAATTCATACCGACACTCTCAACGAGAGTGGTTTTGTTGAGAGTGAGCGGTTCTTATTCCCT
GACAGGAACAAACAAAGCTAATTATATCTAAGGTACCATCGAGGCCTTTGGCGGGCGAACAATCCATACTTACCA
CACCGAGGGCGCAGGCGGAGGCCACGCACCTGATATCATTGTGGTTTGTGGCCAAAACAACGTTTTGCCATCATC
AACCAATCCCACTCGTCCGTATGCCAAGAATACGCTTGATGAACACCTCGACGTAAGTGGAGTTCATTCATATTA
TTTAGCTCGAAATGAAAATTTTACTAGATGCTTATGGTATGTCATCACCTCGATAAATCAATTCCGGAGGACCTC
GATTTTGCGGAGTCGCGTATCAGGGCGGAGACAGTTGCTGCAGAAGATGTTTTGCACGATATCGGTGCGATTTCA
ATGATAAGCTCCGATTCTCAGGCTATGGGCCGTATTGGAGAGGTGATTAGTCGGACATGGAGGACTGCGAGTAAG
ATGAGGGAAGTCCGAGGACCTTTGACAGATCTCGGCGATGATGGTCGGAAAGATAATGCCAGAGTCAAACGTTAT
ATTGCCAAGTATACTGTCAATCCGTATGTGTCCCTTTCAATTCATCTGACAAAGAGTGCTATACTCATTGGATGT
CACCAAATCAAGTGCTATCGCCCATGGCATCAGTCACCTCGTCGGTCACGTCGCAGTAGGCACACTCGCAGATCT
TGTTCTCTGGAAACCTGAAAACTTCGGCTCAAAACCGGAAATGATTCTCAAGGCTGGCGTAATAACATATTCCCA
GGTCGGAGACGCGAATGCATCGATACCCTCTGTTCAACCATTTTACTCTAAACCCATGTGGGGAGCGAAACCAGG
TTCGGCAGCACTTAATTCTGTGGCTTTCGTCTCGCAAGTTTCGATTACGTCGAGGGTGATTGAATCGTATGGATT
GTCAAAGAAGATTGAAGCTGTCAGAGGGTGTAGGGATATTGGTAAGAAGGATATGAAGTGGAATGATACGACCCC
TTCGATGAAGGTGGACCCGGAGAGTTATGAGGTCCGTGCTGATGGTGTACTAATGGATGTAAAGCCTGCAGAGAG
GGTAGCTTTGGCGACACCGTATAATCTATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail