Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080220
Gene name
Locationscaffold_5:538212..540103
Strand-
Gene length (bp)1891
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.3E-19 68 420

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 84 458 1.0E-18
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 84 434 3.0E-15
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 84 443 1.0E-11
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 15 248 6.0E-09

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 68 90 22
3 121 143 22
4 163 185 22
5 303 322 19
6 335 354 19
7 364 386 22
8 435 457 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080220
MHIDPQDYEEHSSHKEKATPLPKMQIFIIMLVMLAEPISSTVIYPFVNQFGIMLGSSSRLSSLRNAQLFSIGAGF
LTGSAVDPFWTLLIARCAQGAFNGNIGVTKTMVTEITDSTNIAQAYAWLPVMWSSGITLGPLIGGLFAQPARRWP
QLSNIKFLVHHPYFLPCAIAGMLALTSFLMAYMGLKESLRPKDILCQTDDADESGKAIYDSDYSSGEESPLLSND
LPRKYGSHPTEDSSSEISTLAPIEKEIPLKDLLTRPLLIALANHAFLAFLDQAHQAILPLMYSTSISLGGLSLRP
RDIGLVMGVWGAFNAVLQVVFFSRIMKWLGPRTMYITCFSALLVTFSAFPVLNMLSKTTGSTNAMVWITICFQMT
FYVAVFMGYGCMQLFIMAAAPTQNSFGAVNALGQMVSSVTRTIAPAFTSSLFSVSIQKHLLGGYFVYFFLLSITS
VGVYASFQLPHQMKLRGGR*
Coding >AgabiH97|080220
ATGCATATCGACCCTCAGGACTATGAAGAGCACTCCTCCCACAAGGAGAAGGCCACCCCTCTTCCCAAAATGCAG
ATCTTCATTATCATGCTAGTCATGCTGGCCGAGCCCATCTCGTCCACCGTCATCTATCCCTTTGTCAACCAGTTT
GGCATTATGCTGGGTTCATCGAGTCGGCTTTCTTCCTTGCGGAATGCACAACTGTTTTCCATTGGGGCAGGCTTT
CTGACCGGATCGGCCGTCGACCCCTTCTGGACACTGTTAATTGCACGCTGTGCACAGGGTGCTTTCAATGGAAAC
ATCGGTGTTACCAAGACTATGGTTACGGAGATTACGGACTCGACGAATATAGCGCAAGCCTATGCCTGGCTTCCT
GTGATGTGGAGTTCGGGAATCACCTTGGGTCCGCTGATAGGAGGGCTTTTCGCACAGCCAGCACGGAGATGGCCC
CAACTCTCCAATATCAAATTCCTCGTACATCACCCTTACTTTCTCCCATGTGCTATCGCTGGAATGCTTGCTCTT
ACTTCATTCCTTATGGCATATATGGGTCTTAAAGAATCTCTACGTCCTAAAGACATCTTGTGCCAAACCGATGAT
GCGGACGAGTCGGGTAAAGCGATTTACGATAGCGATTACTCTTCTGGCGAGGAATCGCCACTTCTATCCAATGAT
CTTCCACGGAAATATGGTTCGCACCCTACCGAGGATTCGAGTAGCGAAATCTCTACGTTGGCGCCAATAGAAAAG
GAAATCCCTCTCAAGGATCTTCTCACTAGGCCATTGTTGATCGCACTTGCCAATCATGCTTTCCTTGCGTTCCTG
GATCAAGCGCATCAGGCCATTTTGCCCCTCATGTACTCGACCTCTATCTCCTTGGGTGGTCTTAGCCTTCGTCCA
CGCGATATTGGCTTGGTCATGGGAGTCTGGGGCGCTTTCAATGCGGTTCTCCAGGTTGTCTTCTTTTCCAGGATC
ATGAAATGGCTTGGACCAAGGACGATGTATATCACTTGCTTCAGCGCGCTCTTGGTTACCTTTTCTGCTTTCCCA
GTCTTGAATATGCTCTCGAAAACGACGGGAAGCACGAATGCTATGGTCTGGATAACGATCTGCTTCCAGATGACA
TTCTACGTTGCGGTTTTCATGGGCTATGGTTGCATGCAATTATTTATTATGGCTGCTGCTCCGACCCAAAATTCT
TTCGGGGCTGTAAATGCTCTGGGCCAGATGGTGAGTTCGGTTACGAGGACGATAGCACCTGCTTTCACTTCGTCG
CTTTTCTCGGTATCTATTCAAAAACATCTTCTTGGGGGTTATTTTGTATATTTCTTTTTACTTTCTATTACATCC
GTTGGCGTGTATGCGTCTTTCCAACTACCACATCAGATGAAACTGCGTGGTGGTAGATAA
Transcript >AgabiH97|080220
ATGCATATCGACCCTCAGGACTATGAAGAGCACTCCTCCCACAAGGAGAAGGCCACCCCTCTTCCCAAAATGCAG
ATCTTCATTATCATGCTAGTCATGCTGGCCGAGCCCATCTCGTCCACCGTCATCTATCCCTTTGTCAACCAGTTT
GGCATTATGCTGGGTTCATCGAGTCGGCTTTCTTCCTTGCGGAATGCACAACTGTTTTCCATTGGGGCAGGCTTT
CTGACCGGATCGGCCGTCGACCCCTTCTGGACACTGTTAATTGCACGCTGTGCACAGGGTGCTTTCAATGGAAAC
ATCGGTGTTACCAAGACTATGGTTACGGAGATTACGGACTCGACGAATATAGCGCAAGCCTATGCCTGGCTTCCT
GTGATGTGGAGTTCGGGAATCACCTTGGGTCCGCTGATAGGAGGGCTTTTCGCACAGCCAGCACGGAGATGGCCC
CAACTCTCCAATATCAAATTCCTCGTACATCACCCTTACTTTCTCCCATGTGCTATCGCTGGAATGCTTGCTCTT
ACTTCATTCCTTATGGCATATATGGGTCTTAAAGAATCTCTACGTCCTAAAGACATCTTGTGCCAAACCGATGAT
GCGGACGAGTCGGGTAAAGCGATTTACGATAGCGATTACTCTTCTGGCGAGGAATCGCCACTTCTATCCAATGAT
CTTCCACGGAAATATGGTTCGCACCCTACCGAGGATTCGAGTAGCGAAATCTCTACGTTGGCGCCAATAGAAAAG
GAAATCCCTCTCAAGGATCTTCTCACTAGGCCATTGTTGATCGCACTTGCCAATCATGCTTTCCTTGCGTTCCTG
GATCAAGCGCATCAGGCCATTTTGCCCCTCATGTACTCGACCTCTATCTCCTTGGGTGGTCTTAGCCTTCGTCCA
CGCGATATTGGCTTGGTCATGGGAGTCTGGGGCGCTTTCAATGCGGTTCTCCAGGTTGTCTTCTTTTCCAGGATC
ATGAAATGGCTTGGACCAAGGACGATGTATATCACTTGCTTCAGCGCGCTCTTGGTTACCTTTTCTGCTTTCCCA
GTCTTGAATATGCTCTCGAAAACGACGGGAAGCACGAATGCTATGGTCTGGATAACGATCTGCTTCCAGATGACA
TTCTACGTTGCGGTTTTCATGGGCTATGGTTGCATGCAATTATTTATTATGGCTGCTGCTCCGACCCAAAATTCT
TTCGGGGCTGTAAATGCTCTGGGCCAGATGGTGAGTTCGGTTACGAGGACGATAGCACCTGCTTTCACTTCGTCG
CTTTTCTCGGTATCTATTCAAAAACATCTTCTTGGGGGTTATTTTGTATATTTCTTTTTACTTTCTATTACATCC
GTTGGCGTGTATGCGTCTTTCCAACTACCACATCAGATGAAACTGCGTGGTGGTAGATAA
Gene >AgabiH97|080220
ATGCATATCGACCCTCAGGACTATGAAGAGCACTCCTCCCACAAGGAGAAGGCCACCCCTCTTCCCAAAATGCAG
ATCTTCATTATCATGCTAGTCATGCTGGCCGAGCCCATCTCGTCCACCGTCATCTATCCCTTTGTCAACCAGTTT
GTGCGCGACACTGGCATTACAGGCGGTGACGAACGTAAAGTAGGGCATTATGCTGGGTTCATCGTGCGTCTTCTG
ACAACGCATATAGCTAACTACCTAAACGCGTTTTAACACTATTTTTCTAGGAGTCGGCTTTCTTCCTTGCGGAAT
GCACAACTGTTTTCCATTGGGGCAGGCTTTCTGACCGGATCGGCCGTCGACCCGTACTGCTTCTCGGTCCTATTG
GTCTCGCTGCTTCATTGTTTACGTTTGGGTTCTCGAACAGCTTCTGGACACTGTTAATTGCACGCTGTGCACAGG
GTGCTTTCAATGGAAACATCGGTACGTTGTCTCCGAGTTGACTCCCACAAGTCCCGTCCGTGTTAAATTTTTTGG
GGCGCCAGGTGTTACCAAGACTATGGTTACGGAGGTTTGTGCTCTCCAAGATGCCGAGGACTTGTTTAGTGTTCT
CATTTCAGTCATTTTCACCCGGATTAGATTACGGACTCGACGAATATAGCGCAAGCCTATGCCTGGCTTCCTGTG
ATGTGGAGTTCGGGAATCACCTTGGGGTGAGCGTTCTTCGCTTTCGTAATTCGGTTCAACGCACCGTTCTCATAA
TTGTGCCTATTTGTTTGCTAGTCCGCTGATAGGAGGGCTTTTCGCACAGCCAGCACGGAGATGGCCCCAACTCTC
CAATATCAAATTCCTCGTACATCACCCTTACTTTCTCCCATGTGCTATCGCTGGAATGCTTGCTCTTACTTCATT
CCTTATGGCATATATGGGTCTTAAAGAAGTAAGCAAGTTCCGCACGAGTAAATCTTGTCGGCTGATTTTTCTGGC
GAACCTTTTCTAGTCTCTACGTCCTAAAGACATCTTGTGCCAAACCGATGATGCGGACGAGTCGGGTAAAGCGAT
TTACGATAGCGATTACTCTTCTGGCGAGGAATCGCCACTTCTATCCAATGATCTTCCACGGAAATATGGTTCGCA
CCCTACCGAGGATTCGAGTAGCGAAATCTCTACGTTGGCGCCAATAGAAAAGGAAATCCCTCTCAAGGATCTTCT
CACTAGGCCATTGTTGATCGCACTTGCCAATCATGCTTTCCTTGCGTTCCTGGATCAAGCGCATCAGGCCATTTT
GCCCCTCATGTACTCGACCTCTATCTCCTTGGGTGGTCTTAGCCTTCGTCCACGCGATATTGGCTTGGTCATGGG
AGTCTGGGGCGCTTTCAATGCGGTTCTCCAGGTTGTCTTCTTTTCCAGGATCATGAAATGGCTTGGACCAAGGAC
GATGTATATCACTTGCTTCAGCGCGCTCTTGGTTACCTTTTCTGCTTTCCCAGTCTTGAATATGCTCTCGAAAAC
GACGGGAAGCACGAATGCTATGGTCTGGATAACGATCTGCTTCCAGATGACATTCTACGTTGCGGTTTTCATGGG
CTATGGTGCGTTCGTCGATCATGAGGTACTTTCATTCATTGATCCACGGTTTTGTGTAGGTTGCATGCAATTATT
TATTATGGCTGCTGCTCCGACCCAAAATTCTTTCGGGGCTGTAAATGCTCTGGGCCAGATGGTGAGTTCGGTTAC
GAGGACGATAGCACCTGCTTTCACTTCGTCGCTTTTCTCGGTATCTATTCAAAAACATCTTCTTGGGGGTTATTT
TGTATATTTCTTTTTACTTTCTATTACATCCGTTGGCGTGTATGCGTCTTTCCAACTACCACATCAGATGAAACT
GCGTGGTGGTAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail