Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080210
Gene name
Locationscaffold_5:535509..537489
Strand-
Gene length (bp)1980
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-26 83 342
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-08 325 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 65 487 7.0E-43
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 72 511 1.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 72 486 5.0E-36
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 72 290 1.0E-32
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 141 407 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 65 487 7.0E-43
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 72 511 1.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 72 486 5.0E-36
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 72 290 1.0E-32
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 141 407 5.0E-13
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 96 515 1.0E-12
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 96 515 1.0E-12
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 96 515 1.0E-12
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 96 515 1.0E-12
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 96 504 2.0E-12
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 96 515 2.0E-12
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 96 515 3.0E-12
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 120 287 7.0E-12
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 96 422 7.0E-12
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 120 287 2.0E-11
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 113 484 1.0E-10
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 140 420 1.0E-10
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 114 403 2.0E-10
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 120 287 2.0E-10
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 114 407 1.0E-09
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 108 393 9.0E-09
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 96 422 6.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 142 228 3.0E-07
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 96 282 4.0E-07
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 107 514 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 117 136 19
2 151 173 22
3 208 230 22
4 250 272 22
5 320 342 22
6 357 376 19
7 388 410 22
8 420 442 22
9 488 510 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080210
MTVVIGDTPTTTTSMDGVVIDEQTALLTPSNDSVDAPNSNSKTLRKRSSDSDLEYQHQRRRKSNQKSNSKSKGLP
KLQIAVVLLLQLCEPLMSQSIYPYINQLVGELDITGGDERKVGYYAGLIESLFFATEAMTVLQWSRFSDHIGRKP
VLLIGLIGSTLSMLCFGLSRTFWTLVISRCLCGLLNGNIGVMKSVMGELTDSSNRAEGFALMPVVWATGSTLGPL
LGGSLSKPYDNFPSVFKSQFWKDYPYFLPCLATSCVAFIVIIFTAVFFKETVPKHKRGRSISSEMTLTEEEEETS
NLNKPLPLRKILIYPVLISISNYVFLAFINIMLNALLPLFLAMPIQIGGLGFSPSTIGYIWGVYGFMTGLFNILF
FAKVMRRFGERKVFLGGMMMFGPCFMLMPVMSLCAKTWGVGVMVWMLIVIVFFMLVIMDMSYGSIFMYVTASAPN
KRSLGATNGLSQMTVSIARAIGPALSTSLFSYSVQKNILGGYGVYLCMTVLSLLGLTLAVRLPEHVWEEKEV*
Coding >AgabiH97|080210
ATGACTGTAGTGATTGGTGATACTCCTACTACGACAACATCTATGGATGGTGTTGTCATAGATGAACAAACTGCT
CTTCTTACTCCATCAAACGACTCAGTTGATGCCCCTAATTCGAATTCGAAGACATTGCGGAAGAGGTCTTCTGAT
TCTGACTTGGAGTATCAACATCAACGGCGGAGAAAATCGAATCAGAAATCGAATTCAAAATCGAAAGGGTTGCCT
AAACTTCAGATTGCGGTTGTGTTGTTGTTACAGCTTTGTGAACCGTTGATGAGTCAATCTATATATCCTTATATC
AATCAACTGGTTGGTGAATTGGATATTACGGGTGGGGATGAACGGAAAGTGGGGTATTATGCTGGACTCATCGAA
TCTTTGTTTTTTGCTACGGAGGCTATGACAGTTCTTCAATGGAGTCGGTTCTCAGATCATATCGGTCGTAAACCA
GTTTTATTGATTGGCCTCATTGGTTCGACTTTGTCCATGTTATGTTTCGGGTTATCCAGGACGTTTTGGACTTTA
GTTATCAGTCGGTGTTTATGTGGTCTTCTTAATGGAAATATCGGTGTAATGAAAAGTGTTATGGGAGAATTAACA
GATTCTTCGAATCGTGCTGAAGGTTTTGCTTTGATGCCTGTCGTTTGGGCTACAGGTTCCACTCTCGGACCTTTG
TTGGGAGGTTCTTTATCGAAACCTTATGACAATTTTCCTTCGGTGTTCAAGAGTCAGTTTTGGAAAGATTATCCG
TATTTTTTGCCTTGCTTGGCTACATCGTGTGTCGCTTTTATTGTTATCATTTTTACGGCCGTTTTTTTCAAAGAG
ACTGTACCGAAACACAAACGAGGAAGATCTATATCTTCCGAAATGACTCTTACCGAAGAAGAAGAAGAAACTTCA
AACCTCAATAAACCTCTTCCTCTTCGTAAAATCCTAATCTACCCCGTCCTCATATCCATATCCAACTACGTCTTC
CTCGCCTTCATCAACATCATGCTCAACGCCCTCTTACCCCTCTTCCTAGCCATGCCTATCCAAATCGGTGGATTA
GGATTCTCACCTTCCACTATCGGTTACATTTGGGGTGTTTATGGATTCATGACTGGTCTTTTTAATATTTTGTTT
TTTGCAAAAGTGATGAGACGATTTGGAGAGAGGAAGGTTTTTTTGGGGGGTATGATGATGTTTGGACCTTGTTTT
ATGTTGATGCCTGTGATGAGTTTGTGTGCGAAGACATGGGGTGTTGGAGTTATGGTTTGGATGTTGATCGTGATT
GTGTTTTTTATGTTGGTTATTATGGATATGTCATACGGATCTATATTTATGTATGTAACCGCTTCGGCACCCAAC
AAACGGTCACTTGGAGCTACAAATGGATTATCACAAATGACGGTTTCGATTGCTCGTGCCATCGGACCCGCACTA
TCAACATCGTTATTTTCGTATTCGGTTCAAAAAAACATTTTGGGAGGGTATGGAGTTTATTTATGTATGACTGTT
TTGTCTCTTCTTGGTCTTACTCTTGCGGTTCGATTGCCGGAACATGTTTGGGAGGAGAAGGAGGTTTGA
Transcript >AgabiH97|080210
ATGACTGTAGTGATTGGTGATACTCCTACTACGACAACATCTATGGATGGTGTTGTCATAGATGAACAAACTGCT
CTTCTTACTCCATCAAACGACTCAGTTGATGCCCCTAATTCGAATTCGAAGACATTGCGGAAGAGGTCTTCTGAT
TCTGACTTGGAGTATCAACATCAACGGCGGAGAAAATCGAATCAGAAATCGAATTCAAAATCGAAAGGGTTGCCT
AAACTTCAGATTGCGGTTGTGTTGTTGTTACAGCTTTGTGAACCGTTGATGAGTCAATCTATATATCCTTATATC
AATCAACTGGTTGGTGAATTGGATATTACGGGTGGGGATGAACGGAAAGTGGGGTATTATGCTGGACTCATCGAA
TCTTTGTTTTTTGCTACGGAGGCTATGACAGTTCTTCAATGGAGTCGGTTCTCAGATCATATCGGTCGTAAACCA
GTTTTATTGATTGGCCTCATTGGTTCGACTTTGTCCATGTTATGTTTCGGGTTATCCAGGACGTTTTGGACTTTA
GTTATCAGTCGGTGTTTATGTGGTCTTCTTAATGGAAATATCGGTGTAATGAAAAGTGTTATGGGAGAATTAACA
GATTCTTCGAATCGTGCTGAAGGTTTTGCTTTGATGCCTGTCGTTTGGGCTACAGGTTCCACTCTCGGACCTTTG
TTGGGAGGTTCTTTATCGAAACCTTATGACAATTTTCCTTCGGTGTTCAAGAGTCAGTTTTGGAAAGATTATCCG
TATTTTTTGCCTTGCTTGGCTACATCGTGTGTCGCTTTTATTGTTATCATTTTTACGGCCGTTTTTTTCAAAGAG
ACTGTACCGAAACACAAACGAGGAAGATCTATATCTTCCGAAATGACTCTTACCGAAGAAGAAGAAGAAACTTCA
AACCTCAATAAACCTCTTCCTCTTCGTAAAATCCTAATCTACCCCGTCCTCATATCCATATCCAACTACGTCTTC
CTCGCCTTCATCAACATCATGCTCAACGCCCTCTTACCCCTCTTCCTAGCCATGCCTATCCAAATCGGTGGATTA
GGATTCTCACCTTCCACTATCGGTTACATTTGGGGTGTTTATGGATTCATGACTGGTCTTTTTAATATTTTGTTT
TTTGCAAAAGTGATGAGACGATTTGGAGAGAGGAAGGTTTTTTTGGGGGGTATGATGATGTTTGGACCTTGTTTT
ATGTTGATGCCTGTGATGAGTTTGTGTGCGAAGACATGGGGTGTTGGAGTTATGGTTTGGATGTTGATCGTGATT
GTGTTTTTTATGTTGGTTATTATGGATATGTCATACGGATCTATATTTATGTATGTAACCGCTTCGGCACCCAAC
AAACGGTCACTTGGAGCTACAAATGGATTATCACAAATGACGGTTTCGATTGCTCGTGCCATCGGACCCGCACTA
TCAACATCGTTATTTTCGTATTCGGTTCAAAAAAACATTTTGGGAGGGTATGGAGTTTATTTATGTATGACTGTT
TTGTCTCTTCTTGGTCTTACTCTTGCGGTTCGATTGCCGGAACATGTTTGGGAGGAGAAGGAGGTTTGA
Gene >AgabiH97|080210
ATGACTGTAGTGATTGGTGATACTCCTACTACGACAACATCTATGGATGGTGTTGTCATAGATGAACAAACTGCT
CTTCTTACTCCATCAAACGACTCAGTTGATGCCCCTAATTCGAATTCGAAGACATTGCGGAAGAGGTCTTCTGAT
TCTGACTTGGAGTATCAACATCAACGGCGGAGAAAATCGAATCAGAAATCGAATTCAAAATCGAAAGGGTTGCCT
AAACTTCAGATTGCGGTTGTGTTGTTGTTACAGCTTTGTGAACCGTTGATGAGTCAATCTATATATCCTTATATC
AATCAAGTAAGTTGTTTATGCGTTTTTTTTTTTTTTTTCAATTTTCAATTTCTTATTCTCTTTTTTTTTTTAGCT
GGTTGGTGAATTGGATATTACGGGTGGGGATGAACGGAAAGTGGGGTATTATGCTGGACTCATCGTTGAGTTGTG
TTCTTATTCTATCGTCTTTCTCAAATTTGATCAACTTTTCTCTTAGGAATCTTTGTTTTTTGCTACGGAGGCTAT
GACAGTTCTTCAATGGAGTCGGTTCTCAGATCATATCGGTCGTAAACCAGTTTTATTGATTGGCCTCATTGGTTC
GACTTTGTCCATGTTATGTTTCGGGTTATCCAGGACGTTTTGGACTTTAGTTATCAGGTAAAAAAAGTGTGGTTT
TCGTTATGGATATTTGATTGTTGATGCTTTTTTTTTTGGATTTATAGTCGGTGTTTATGTGGTCTTCTTAATGGA
AATATCGGTATGTTATCTTTTTATAAACGTTTATCTCCTCTTTTACTTGACTACTCAAAGGTGTAATGAAAAGTG
TTATGGGAGAATTAACAGATTCTTCGAATCGTGCTGAAGGTTTTGCTTTGATGCCTGTCGTTTGGGCTACAGGTT
CCACTCTCGGGTCAGTTCCCGACTTTTCTTATTTCACTTTTTCACTTTTAAGGGATGGTTAATTAATGGATTTTT
AGACCTTTGTTGGGAGGTTCTTTATCGAAACCTTATGACAATTTTCCTTCGGTGTTCAAGAGTCAGTTTTGGAAA
GATTATCCGTATTTTTTGCCTTGCTTGGCTACATCGTGTGTCGCTTTTATTGTTATCATTTTTACGGCCGTTTTT
TTCAAAGAGGTGAGCAAGTGCAGTTCAATTGAGATAATTTTTTTTTGATGATTTTCAAAAGACTGTACCGAAACA
CAAACGAGGAAGATCTATATCTTCCGAAATGACTCTTACCGAAGAAGAAGAAGAAACTTCAAACCTCAATAAACC
TCTTCCTCTTCGTAAAATCCTAATCTACCCCGTCCTCATATCCATATCCAACTACGTCTTCCTCGCCTTCATCAA
CATCATGCTCAACGCCCTCTTACCCCTCTTCCTAGCCATGCCTATCCAAATCGGTGGATTAGGATTCTCACCTTC
CACTATCGGTTACATTTGGGGTGTTTATGGATTCATGACTGGTCTTTTTAATATTTTGTTTTTTGCAAAAGTGAT
GAGACGATTTGGAGAGAGGAAGGTTTTTTTGGGGGGTATGATGATGTTTGGACCTTGTTTTATGTTGATGCCTGT
GATGAGTTTGTGTGCGAAGACATGGGGTGTTGGAGTTATGGTTTGGATGTTGATCGTGATTGTGTTTTTTATGTT
GGTTATTATGGATATGTCATACGGTAAGAGTGGCATCCGTTTTTTTGTAATCCTCTCTCACCTCTTTAAACAGGA
TCTATATTTATGTATGTAACCGCTTCGGCACCCAACAAACGGTCACTTGGAGCTACAAATGGATTATCACAAATG
ACGGTTTCGATTGCTCGTGCCATCGGACCCGCACTATCAACATCGTTATTTTCGTATTCGGTTCAAAAAAACATT
TTGGGAGGGTATGGAGTTTATTTATGTATGACTGTTTTGTCTCTTCTTGGTCTTACTCTTGCGGTTCGATTGCCG
GAACATGTTTGGGAGGAGAAGGAGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail