Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080070
Gene name
Locationscaffold_5:499721..500729
Strand+
Gene length (bp)1008
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 2.2E-23 132 254
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 8.3E-09 133 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 118 256 3.0E-11
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 138 255 6.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 138 255 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 5.45 1.50 9.40
Initials Initials knots 10.62 4.82 16.43
Pileal_Stipeal_center Stage I stipe center 23.13 11.71 34.55
Pileal_Stipeal_shell Stage I stipe shell 9.37 4.12 14.62
DIF_stipe_center Stage II stipe center 23.40 11.88 34.92
DIF_stipe_shell Stage II stipe shell 33.19 17.53 48.84
DIF_stipe_skin Stage II stipe skin 23.20 11.79 34.61
DIF_cap_skin Stage II cap skin 18.36 8.98 27.74
DIF_cap_tissue Stage II cap tissue 21.16 10.60 31.71
DIF_gill_tissue Stage II gill tissue 19.64 9.27 30.01
YFB_stipe_center Young fruiting body stipe center 37.53 19.77 55.29
YFB_stipe_shell Young fruiting body stipe shell 48.60 26.48 70.73
YFB_stipe_skin Young fruiting body stipe skin 29.55 15.06 44.04
YFB_cap_skin Young fruiting body cap skin 27.30 13.96 40.64
YFB_cap_tissue Young fruiting body cap tissue 74.93 43.76 106.10
YFB_gill_tissue Young fruiting body gill tissue 15.57 7.39 23.75
YFB_veil Young fruiting body veil 16.82 8.19 25.45

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.001140 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.010412 yes
Casing YFB_veil 0.004548 yes
Casing Initials 0.124851 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.249089 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.002084 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.068270 no
DIF_gill_tissue YFB_stipe_shell 0.004160 yes
DIF_gill_tissue YFB_stipe_skin 0.322151 no
DIF_gill_tissue YFB_cap_skin 0.459947 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.670446 no
DIF_gill_tissue YFB_veil 0.793736 no
YFB_stipe_center YFB_stipe_shell 0.526281 no
YFB_stipe_center YFB_stipe_skin 0.586866 no
YFB_stipe_center YFB_cap_skin 0.428091 no
YFB_stipe_center YFB_cap_tissue 0.017507 yes
YFB_stipe_center YFB_gill_tissue 0.008121 yes
YFB_stipe_center YFB_veil 0.012274 yes
YFB_stipe_shell YFB_stipe_skin 0.129695 no
YFB_stipe_shell YFB_cap_skin 0.065276 no
YFB_stipe_shell YFB_cap_tissue 0.167242 no
YFB_stipe_shell YFB_gill_tissue 0.001140 yes
YFB_stipe_shell YFB_veil 0.001140 yes
YFB_stipe_skin YFB_cap_skin 0.896523 no
YFB_stipe_skin YFB_cap_tissue 0.001625 yes
YFB_stipe_skin YFB_gill_tissue 0.065276 no
YFB_stipe_skin YFB_veil 0.113966 no
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.119465 no
YFB_cap_skin YFB_veil 0.185580 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.909459 no
Initials DIF_gill_tissue 0.108233 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.002951 yes
Initials YFB_cap_skin 0.005671 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.386494 no
Initials YFB_veil 0.257674 no
Initials Pileal_Stipeal_center 0.024444 yes
Initials Pileal_Stipeal_shell 0.849797 no
Initials DIF_stipe_center 0.022111 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.023415 yes
Initials DIF_cap_skin 0.138696 no
Initials DIF_cap_tissue 0.048834 yes
Pileal_Stipeal_center DIF_gill_tissue 0.779429 no
Pileal_Stipeal_center YFB_stipe_center 0.172950 no
Pileal_Stipeal_center YFB_stipe_shell 0.018896 yes
Pileal_Stipeal_center YFB_stipe_skin 0.598606 no
Pileal_Stipeal_center YFB_cap_skin 0.760197 no
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.341142 no
Pileal_Stipeal_center YFB_veil 0.475436 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.009123 yes
Pileal_Stipeal_center DIF_stipe_center 0.987285 no
Pileal_Stipeal_center DIF_stipe_shell 0.364332 no
Pileal_Stipeal_center DIF_stipe_skin 0.995947 no
Pileal_Stipeal_center DIF_cap_skin 0.633359 no
Pileal_Stipeal_center DIF_cap_tissue 0.888070 no
Pileal_Stipeal_shell DIF_gill_tissue 0.048212 yes
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.002084 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.215960 no
Pileal_Stipeal_shell YFB_veil 0.126752 no
Pileal_Stipeal_shell DIF_stipe_center 0.007439 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.009123 yes
Pileal_Stipeal_shell DIF_cap_skin 0.067520 no
Pileal_Stipeal_shell DIF_cap_tissue 0.020260 yes
DIF_stipe_center DIF_gill_tissue 0.753681 no
DIF_stipe_center YFB_stipe_center 0.182683 no
DIF_stipe_center YFB_stipe_shell 0.020790 yes
DIF_stipe_center YFB_stipe_skin 0.612501 no
DIF_stipe_center YFB_cap_skin 0.775117 no
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.315681 no
DIF_stipe_center YFB_veil 0.446272 no
DIF_stipe_center DIF_stipe_shell 0.375995 no
DIF_stipe_center DIF_stipe_skin 0.989983 no
DIF_stipe_center DIF_cap_skin 0.601101 no
DIF_stipe_center DIF_cap_tissue 0.866900 no
DIF_stipe_shell DIF_gill_tissue 0.157833 no
DIF_stipe_shell YFB_stipe_center 0.823069 no
DIF_stipe_shell YFB_stipe_shell 0.277589 no
DIF_stipe_shell YFB_stipe_skin 0.835884 no
DIF_stipe_shell YFB_cap_skin 0.686696 no
DIF_stipe_shell YFB_cap_tissue 0.006032 yes
DIF_stipe_shell YFB_gill_tissue 0.025458 yes
DIF_stipe_shell YFB_veil 0.040501 yes
DIF_stipe_shell DIF_stipe_skin 0.363532 no
DIF_stipe_shell DIF_cap_skin 0.072150 no
DIF_stipe_shell DIF_cap_tissue 0.212940 no
DIF_stipe_skin DIF_gill_tissue 0.771301 no
DIF_stipe_skin YFB_stipe_center 0.178069 no
DIF_stipe_skin YFB_stipe_shell 0.016669 yes
DIF_stipe_skin YFB_stipe_skin 0.600400 no
DIF_stipe_skin YFB_cap_skin 0.762563 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.334080 no
DIF_stipe_skin YFB_veil 0.466797 no
DIF_stipe_skin DIF_cap_skin 0.622566 no
DIF_stipe_skin DIF_cap_tissue 0.882038 no
DIF_cap_skin DIF_gill_tissue 0.921281 no
DIF_cap_skin YFB_stipe_center 0.027205 yes
DIF_cap_skin YFB_stipe_shell 0.001140 yes
DIF_cap_skin YFB_stipe_skin 0.182058 no
DIF_cap_skin YFB_cap_skin 0.291439 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.771266 no
DIF_cap_skin YFB_veil 0.891198 no
DIF_cap_skin DIF_cap_tissue 0.800979 no
DIF_cap_tissue DIF_gill_tissue 0.914189 no
DIF_cap_tissue YFB_stipe_center 0.086914 no
DIF_cap_tissue YFB_stipe_shell 0.007439 yes
DIF_cap_tissue YFB_stipe_skin 0.417331 no
DIF_cap_tissue YFB_cap_skin 0.572868 no
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.500175 no
DIF_cap_tissue YFB_veil 0.641625 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080070
MMFSWNLVSLVAVVLNAASAVISLPVASESASVPTSSTLPITTTVPSDVTSTVVLPTTSEVPTLVPPSTSVPSTV
VPTTTTGVPSTVVPTTTTGVPSTVVPTTTASIPSTITFPTTTGSPTPTPVPFVQINPNGNTAKCLDVQGAVLANG
TPVQIFDCNQTPAQQWVIAPGQGQVQLANTTFCLDAGASPASGTGMKIWECFDNLPAQDWFYTDDKRVALTNQGF
CLDLTNGDLTNGSQAQVWKCTDNNTNQIWTTSTVAVPLPDPPMSTLVAA*
Coding >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTT
CAATTGGCGAATACTACTTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAA
TGCTTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTC
TGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACC
AACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Transcript >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTT
CAATTGGCGAATACTACTTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAA
TGCTTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTC
TGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACC
AACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Gene >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATGTTTGTTGTTTTCTTCAAATTCTCACACCCGTGGCAGCAAATGCTCACGTTTTCGTAACAG
TTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTTCAATTGGCGAATAC
TACTTTCTGTTTGGACGCCGGTGCTTGTAAGTATACCAAACATAAAGTGTCAAATTCTACGGTGCTAATCAAATT
TCTAAAAATAAAACAATAGCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAATGCTTCGATAACTTACCAGCT
CAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGTAAAGGCGGGATATACTATATGTAG
AAAACCGCAACTAATGATTCCTTTAAAGGCTTCTGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAA
GCACAGGTTTGGAAGTGCACGGACAACAATACCAACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCG
GACCCGCCGATGTCCACACTGGTAGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail