Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080070
Gene name
Locationscaffold_5:499721..500729
Strand+
Gene length (bp)1008
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 2.2E-23 132 254
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 8.3E-09 133 199

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 118 256 3.0E-11
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 138 255 6.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 138 255 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080070
MMFSWNLVSLVAVVLNAASAVISLPVASESASVPTSSTLPITTTVPSDVTSTVVLPTTSEVPTLVPPSTSVPSTV
VPTTTTGVPSTVVPTTTTGVPSTVVPTTTASIPSTITFPTTTGSPTPTPVPFVQINPNGNTAKCLDVQGAVLANG
TPVQIFDCNQTPAQQWVIAPGQGQVQLANTTFCLDAGASPASGTGMKIWECFDNLPAQDWFYTDDKRVALTNQGF
CLDLTNGDLTNGSQAQVWKCTDNNTNQIWTTSTVAVPLPDPPMSTLVAA*
Coding >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTT
CAATTGGCGAATACTACTTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAA
TGCTTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTC
TGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACC
AACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Transcript >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATTTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTT
CAATTGGCGAATACTACTTTCTGTTTGGACGCCGGTGCTTCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAA
TGCTTCGATAACTTACCAGCTCAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGCTTC
TGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAAGCACAGGTTTGGAAGTGCACGGACAACAATACC
AACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCGGACCCGCCGATGTCCACACTGGTAGCTGCATGA
Gene >AgabiH97|080070
ATGATGTTCTCTTGGAACTTGGTCTCCCTGGTGGCAGTCGTGCTCAATGCAGCCAGCGCAGTGATCTCCCTCCCT
GTCGCATCCGAATCTGCCTCCGTTCCAACTAGCTCTACGCTCCCTATCACTACCACTGTCCCTTCTGATGTTACT
TCGACCGTTGTTCTCCCTACCACCAGCGAAGTTCCTACTCTTGTCCCCCCTTCCACTAGTGTTCCTTCTACCGTA
GTCCCCACTACTACCACCGGTGTTCCCTCTACCGTTGTCCCTACTACTACCACCGGTGTTCCTTCTACCGTTGTC
CCTACTACTACTGCCAGTATCCCGTCTACCATCACTTTCCCCACCACTACTGGTTCTCCCACCCCTACTCCTGTA
CCCTTTGTGCAGATCAACCCTAACGGAAACACTGCCAAGTGCTTGGACGTCCAAGGCGCAGTTCTCGCGAACGGA
ACCCCTGTCCAAATGTTTGTTGTTTTCTTCAAATTCTCACACCCGTGGCAGCAAATGCTCACGTTTTCGTAACAG
TTTTGATTGTAATCAAACTCCTGCTCAACAATGGGTCATTGCACCTGGCCAAGGTCAAGTTCAATTGGCGAATAC
TACTTTCTGTTTGGACGCCGGTGCTTGTAAGTATACCAAACATAAAGTGTCAAATTCTACGGTGCTAATCAAATT
TCTAAAAATAAAACAATAGCGCCAGCTTCCGGTACTGGAATGAAGATCTGGGAATGCTTCGATAACTTACCAGCT
CAGGATTGGTTCTACACTGATGACAAGAGGGTCGCTCTCACCAACCAAGGTAAAGGCGGGATATACTATATGTAG
AAAACCGCAACTAATGATTCCTTTAAAGGCTTCTGTCTCGATCTCACCAATGGAGACTTGACCAACGGAAGCCAA
GCACAGGTTTGGAAGTGCACGGACAACAATACCAACCAGATCTGGACCACCTCTACGGTCGCAGTTCCTCTCCCG
GACCCGCCGATGTCCACACTGGTAGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail