Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080060
Gene name
Locationscaffold_5:497222..498638
Strand+
Gene length (bp)1416
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 7.6E-23 279 404
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 6.3E-09 276 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 288 410 3.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 288 410 1.0E-08
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 192 351 9.0E-08
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 254 404 1.0E-07
sp|Q8N1N5|CRPAK_HUMAN Cysteine-rich PAK1 inhibitor OS=Homo sapiens GN=CRIPAK PE=1 SV=1 47 266 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 288 410 3.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 288 410 1.0E-08
sp|Q05308|SP1_RARFA Serine protease 1 OS=Rarobacter faecitabidus PE=1 SV=1 192 351 9.0E-08
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 254 404 1.0E-07
sp|Q8N1N5|CRPAK_HUMAN Cysteine-rich PAK1 inhibitor OS=Homo sapiens GN=CRIPAK PE=1 SV=1 47 266 7.0E-07
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 287 360 7.0E-07
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 287 360 8.0E-07
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 16 282 8.0E-07
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 29 287 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080060
MHSRNFIRLATLLNVASVVLSAALTFSASTSTVSASSIPASSIPASSSIPAPSSVPVSSSVPATSVPASSSMATT
FTSSVPASSSVPVSSSVPVSSSVPVSSSVPVSSSVPASSSVPVTSVPASSSMATTFTSSVPASSVPVSSSAPASS
SIPTSSSVPASSSMATTITSSIPASSSIPASSSIPVSSSVPATSVPASSSTVITLTSSVPGSSSPVTTITSSAPA
SSSPVTTLSSSVPASSSPATTITSSVPATSSLPVTSTTTVSTPPPSGTPTPSFQIHPNGNTAKCLDVQGDIIENG
TPVQIYDCNGTPAQNWIIVPGEGHVQLAATNHCLDAGATPVDGTKMKIWECFDNLPAQDWFYTDDHRISLTNQGS
CLDLTEGNLTNGNVVQVWKCTDFNANQIWSVSNGTSGPA*
Coding >AgabiH97|080060
ATGCACTCCAGGAACTTTATTCGCTTGGCCACTTTGCTCAATGTGGCGAGCGTAGTGCTTTCCGCGGCCCTTACC
TTCTCGGCCTCTACCTCTACTGTTTCTGCCTCTTCCATTCCAGCTTCCTCTATACCAGCCTCTTCCTCTATACCA
GCCCCATCTTCTGTACCGGTCTCTTCTTCTGTACCGGCGACTTCGGTCCCCGCCTCCTCAAGTATGGCGACCACA
TTCACCTCCTCAGTCCCAGCCTCTTCTTCTGTACCTGTCTCTTCGTCTGTACCAGTCTCTTCTTCCGTACCAGTC
TCTTCTTCCGTACCAGTCTCTTCTTCCGTACCAGCGTCTTCGTCTGTACCAGTGACTTCGGTCCCGGCCTCCTCG
AGTATGGCTACCACTTTCACTTCCTCAGTTCCAGCCTCTTCTGTACCGGTGTCGTCTTCCGCACCCGCGTCTTCA
TCTATTCCAACCTCTTCTTCTGTCCCGGCCTCCTCGAGTATGGCGACCACAATCACCTCCTCAATCCCAGCCTCT
TCTTCCATCCCAGCTTCTTCGTCTATTCCAGTTTCTTCCTCCGTACCAGCGACTTCGGTCCCGGCCTCCTCGAGT
ACGGTTATCACCTTAACCTCCTCGGTGCCTGGTTCCTCTAGCCCGGTTACTACCATCACCTCGTCGGCTCCAGCT
TCATCGAGTCCAGTTACCACCCTTAGTTCTTCAGTCCCGGCCTCATCGAGCCCGGCTACTACCATCACCTCTTCT
GTCCCCGCCACCTCTTCACTTCCGGTTACCAGCACCACTACAGTTTCCACTCCTCCTCCATCTGGTACACCGACT
CCTTCTTTCCAGATCCACCCCAATGGAAACACGGCGAAGTGTTTGGACGTTCAAGGGGATATCATTGAGAATGGG
ACGCCAGTTCAAATTTATGATTGCAATGGGACACCTGCCCAGAATTGGATTATTGTACCGGGAGAAGGCCACGTC
CAACTGGCTGCCACTAACCATTGTTTGGATGCTGGTGCTACTCCAGTCGATGGTACTAAAATGAAGATTTGGGAA
TGTTTCGATAATTTGCCTGCTCAGGATTGGTTCTACACTGATGACCACAGGATTTCTCTTACCAATCAAGGTTCC
TGCCTCGATCTCACCGAGGGTAATTTGACCAATGGAAATGTGGTACAAGTTTGGAAATGCACCGACTTCAATGCC
AACCAAATTTGGAGCGTTTCTAACGGTACTTCTGGTCCAGCTTGA
Transcript >AgabiH97|080060
ATGCACTCCAGGAACTTTATTCGCTTGGCCACTTTGCTCAATGTGGCGAGCGTAGTGCTTTCCGCGGCCCTTACC
TTCTCGGCCTCTACCTCTACTGTTTCTGCCTCTTCCATTCCAGCTTCCTCTATACCAGCCTCTTCCTCTATACCA
GCCCCATCTTCTGTACCGGTCTCTTCTTCTGTACCGGCGACTTCGGTCCCCGCCTCCTCAAGTATGGCGACCACA
TTCACCTCCTCAGTCCCAGCCTCTTCTTCTGTACCTGTCTCTTCGTCTGTACCAGTCTCTTCTTCCGTACCAGTC
TCTTCTTCCGTACCAGTCTCTTCTTCCGTACCAGCGTCTTCGTCTGTACCAGTGACTTCGGTCCCGGCCTCCTCG
AGTATGGCTACCACTTTCACTTCCTCAGTTCCAGCCTCTTCTGTACCGGTGTCGTCTTCCGCACCCGCGTCTTCA
TCTATTCCAACCTCTTCTTCTGTCCCGGCCTCCTCGAGTATGGCGACCACAATCACCTCCTCAATCCCAGCCTCT
TCTTCCATCCCAGCTTCTTCGTCTATTCCAGTTTCTTCCTCCGTACCAGCGACTTCGGTCCCGGCCTCCTCGAGT
ACGGTTATCACCTTAACCTCCTCGGTGCCTGGTTCCTCTAGCCCGGTTACTACCATCACCTCGTCGGCTCCAGCT
TCATCGAGTCCAGTTACCACCCTTAGTTCTTCAGTCCCGGCCTCATCGAGCCCGGCTACTACCATCACCTCTTCT
GTCCCCGCCACCTCTTCACTTCCGGTTACCAGCACCACTACAGTTTCCACTCCTCCTCCATCTGGTACACCGACT
CCTTCTTTCCAGATCCACCCCAATGGAAACACGGCGAAGTGTTTGGACGTTCAAGGGGATATCATTGAGAATGGG
ACGCCAGTTCAAATTTATGATTGCAATGGGACACCTGCCCAGAATTGGATTATTGTACCGGGAGAAGGCCACGTC
CAACTGGCTGCCACTAACCATTGTTTGGATGCTGGTGCTACTCCAGTCGATGGTACTAAAATGAAGATTTGGGAA
TGTTTCGATAATTTGCCTGCTCAGGATTGGTTCTACACTGATGACCACAGGATTTCTCTTACCAATCAAGGTTCC
TGCCTCGATCTCACCGAGGGTAATTTGACCAATGGAAATGTGGTACAAGTTTGGAAATGCACCGACTTCAATGCC
AACCAAATTTGGAGCGTTTCTAACGGTACTTCTGGTCCAGCTTGA
Gene >AgabiH97|080060
ATGCACTCCAGGAACTTTATTCGCTTGGCCACTTTGCTCAATGTGGCGAGCGTAGTGCTTTCCGCGGCCCTTACC
TTCTCGGCCTCTACCTCTACTGTTTCTGCCTCTTCCATTCCAGCTTCCTCTATACCAGCCTCTTCCTCTATACCA
GCCCCATCTTCTGTACCGGTCTCTTCTTCTGTACCGGCGACTTCGGTCCCCGCCTCCTCAAGTATGGCGACCACA
TTCACCTCCTCAGTCCCAGCCTCTTCTTCTGTACCTGTCTCTTCGTCTGTACCAGTCTCTTCTTCCGTACCAGTC
TCTTCTTCCGTACCAGTCTCTTCTTCCGTACCAGCGTCTTCGTCTGTACCAGTGACTTCGGTCCCGGCCTCCTCG
AGTATGGCTACCACTTTCACTTCCTCAGTTCCAGCCTCTTCTGTACCGGTGTCGTCTTCCGCACCCGCGTCTTCA
TCTATTCCAACCTCTTCTTCTGTCCCGGCCTCCTCGAGTATGGCGACCACAATCACCTCCTCAATCCCAGCCTCT
TCTTCCATCCCAGCTTCTTCGTCTATTCCAGTTTCTTCCTCCGTACCAGCGACTTCGGTCCCGGCCTCCTCGAGT
ACGGTTATCACCTTAACCTCCTCGGTGCCTGGTTCCTCTAGCCCGGTTACTACCATCACCTCGTCGGCTCCAGCT
TCATCGAGTCCAGTTACCACCCTTAGTTCTTCAGTCCCGGCCTCATCGAGCCCGGCTACTACCATCACCTCTTCT
GTCCCCGCCACCTCTTCACTTCCGGTTACCAGCACCACTACAGTTTCCACTCCTCCTCCATCTGGTACACCGACT
CCTTCTTTCCAGATCCACCCCAATGGAAACACGGCGAAGTGTTTGGACGTTCAAGGGGATATCATTGAGAATGGG
ACGCCAGTTCAAATGTACGTTTGCATCATTAGAGCCGATCGAGCACTTTACTCATACTATGAAAATAACAGTTAT
GATTGCAATGGGACACCTGCCCAGAATTGGATTATTGTACCGGGAGAAGGCCACGTCCAACTGGCTGCCACTAAC
CATTGTTTGGATGCTGGTGCTAGTAGGTGTAATAATGCGACCGATTGCGCATTAGTACTGACATCTTATAAATTA
GCTCCAGTCGATGGTACTAAAATGAAGATTTGGGAATGTTTCGATAATTTGCCTGCTCAGGATTGGTTCTACACT
GATGACCACAGGATTTCTCTTACCAATCAAGGTAAAAGACCTGATGATATGATGAAAACCTCAAAACTGAGCTGA
TAATCTTTCATTCAAGGTTCCTGCCTCGATCTCACCGAGGGTAATTTGACCAATGGAAATGTGGTACAAGTTTGG
AAATGCACCGACTTCAATGCCAACCAAATTTGGAGCGTTTCTAACGGTACTTCTGGTCCAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail