Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|080050
Gene name
Locationscaffold_5:492201..494764
Strand+
Gene length (bp)2563
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 4.6E-18 217 420
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 4.5E-19 218 416
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.4E-09 216 416
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 2.1E-07 290 410
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.8E-06 219 254
PF01494 FAD_binding_3 FAD binding domain 3.4E-05 216 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 218 557 1.0E-30
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 218 556 3.0E-30
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 215 556 2.0E-29
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 218 556 6.0E-29
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 218 556 8.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 218 557 1.0E-30
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 218 556 3.0E-30
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 215 556 2.0E-29
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 218 556 6.0E-29
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 218 556 8.0E-29
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 217 557 1.0E-28
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 218 557 2.0E-28
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 218 557 9.0E-28
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 214 557 1.0E-26
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 218 445 2.0E-25
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 215 422 4.0E-24
sp|Q5L2G3|CZCO_GEOKA Uncharacterized oxidoreductase CzcO-like OS=Geobacillus kaustophilus (strain HTA426) GN=GK0582 PE=4 SV=1 217 404 1.0E-15
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 217 589 4.0E-15
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 217 553 1.0E-14
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 217 553 2.0E-14
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 217 639 2.0E-14
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 217 553 5.0E-14
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 217 553 5.0E-14
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 217 553 5.0E-14
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 217 553 2.0E-13
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 217 553 2.0E-13
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 217 553 2.0E-13
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 217 553 2.0E-13
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 217 400 3.0E-13
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 217 553 5.0E-13
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 217 553 5.0E-13
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 213 553 5.0E-13
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 217 553 8.0E-13
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 217 400 1.0E-12
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 217 554 1.0E-12
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 217 400 2.0E-12
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 217 589 2.0E-12
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 217 602 4.0E-12
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 217 602 4.0E-12
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 217 553 5.0E-12
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 217 400 5.0E-12
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 217 553 7.0E-12
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 217 553 7.0E-12
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 217 602 1.0E-11
sp|A7Z1S7|CZCO_BACMF Uncharacterized oxidoreductase CzcO OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcO PE=3 SV=1 218 401 2.0E-11
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 217 602 2.0E-11
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 217 555 2.0E-11
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 203 602 4.0E-11
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 217 602 2.0E-10
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 217 602 2.0E-10
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 217 602 2.0E-10
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 217 555 2.0E-10
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 217 418 3.0E-10
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 217 400 9.0E-10
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 214 424 1.0E-09
sp|O07085|CZCO_BACSU Uncharacterized oxidoreductase CzcO OS=Bacillus subtilis (strain 168) GN=czcO PE=1 SV=1 218 401 1.0E-09
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 215 602 2.0E-09
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 215 602 2.0E-09
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 215 602 2.0E-09
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 217 400 2.0E-09
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 213 553 7.0E-09
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 217 420 1.0E-08
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 217 426 4.0E-08
sp|B3QJ15|FENR_RHOPT Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_4475 PE=3 SV=1 209 413 1.0E-07
sp|Q6N2U4|FENR_RHOPA Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA3954 PE=3 SV=1 209 413 1.0E-07
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 217 602 2.0E-07
sp|A4YXZ8|FENR_BRASO Ferredoxin--NADP reductase OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO5079 PE=3 SV=1 211 413 3.0E-07
sp|Q2ITC6|FENR_RHOP2 Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_3841 PE=3 SV=1 209 413 3.0E-07
sp|P23160|R34K_CLOPA 34.2 kDa protein in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 211 418 2.0E-06
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 217 414 3.0E-06
sp|A5EMW5|FENR_BRASB Ferredoxin--NADP reductase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_5550 PE=3 SV=1 211 424 3.0E-06
sp|Q219B6|FENR_RHOPB Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_1458 PE=3 SV=1 211 424 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0004497 monooxygenase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|080050
MTTSAAHPSEAPLPTLNKLGISSLPEDIDARKVASEWFALFADKVTSNDPEGITNLLVQSSFDSGRPETADQVSV
YWRDLLALTWNFRSFEGTTQIREFLTDRLTSAKIANLKLKTSDDAEGLAPVFARPMPDLVWITGFFTFETDVGFC
SGIFRLVPTLDEQQRVQWKAHCIFTNLEELRGFPEKVGNLRDPTPYSGGWEKLREKEKLFEDTEPTVLIVGAGQS
GLTAAARLKLLGISSVLIEKNERVGDNWRNRYDVLCLHDPVWYDHMPYIPFPENWPIYSPSKKLANWLEFYADSM
ELNVWTSTTVSHIEREQSTGLFKVKVQHKNKGFERIFTVKHVVLAPGFSGGSWYTPTYPGMDKFKGQIIHSSEYK
KAEDYLGKKVILVGSCTSAHDIGMDLYDNGIDVTMYQRSSTHVITAQSVVNVFFKGLFDETGPPITVADKVAATF
PNLLNVGIHHRGTLAAEEAEKEMLDNLRRVGFNLNRGYKDAGVLLTAFTRAGGYYLDVGGSQYVIDGKIKLKSKS
TMEGFTETGINFADGSQLEADVVVFCTGLGSTRDVIKAFLDPKTFQNVNEIWGYNNEMEFNGIYGDTGVPNLWYM
MGSLGLCRFYSKRLALQIKAIEEGVFGERYKSNVKGLSF*
Coding >AgabiH97|080050
ATGACCACTTCTGCAGCTCATCCTTCTGAAGCGCCCTTGCCCACTCTAAATAAACTCGGTATCTCTTCTCTTCCG
GAGGATATTGATGCTCGAAAGGTAGCAAGCGAGTGGTTTGCATTGTTCGCAGACAAGGTTACCTCAAACGACCCT
GAAGGGATCACGAATCTCCTCGTTCAATCGTCTTTTGACTCTGGCCGTCCTGAGACTGCAGACCAAGTTTCTGTT
TACTGGCGCGACTTACTTGCTCTCACTTGGAATTTCCGTTCTTTCGAGGGCACCACTCAAATTCGCGAGTTTTTG
ACGGATCGTCTTACAAGTGCTAAAATCGCCAACTTGAAGTTGAAGACCTCAGACGATGCAGAAGGATTGGCACCG
GTTTTTGCACGACCAATGCCAGATTTGGTTTGGATTACTGGGTTTTTTACATTCGAAACCGACGTCGGCTTTTGT
TCGGGTATATTCCGACTTGTGCCTACCTTGGATGAGCAGCAACGAGTTCAGTGGAAAGCGCACTGTATCTTCACA
AATTTGGAGGAGTTGAGAGGATTCCCTGAGAAGGTTGGAAATCTGCGTGATCCAACGCCTTATAGCGGAGGATGG
GAAAAGCTTCGAGAGAAAGAGAAGCTATTTGAAGATACCGAACCCACTGTGCTGATTGTGGGAGCTGGTCAAAGC
GGTCTGACAGCTGCAGCAAGATTGAAACTTCTTGGGATATCAAGTGTTTTGATAGAGAAGAATGAAAGAGTAGGA
GATAATTGGAGAAATCGATATGACGTCTTGTGTCTTCATGATCCCGTCTGGTACGACCACATGCCATACATCCCT
TTCCCTGAGAATTGGCCTATCTACTCCCCCTCGAAGAAGCTAGCGAATTGGTTAGAATTTTACGCAGACTCGATG
GAATTAAATGTCTGGACCTCAACAACGGTTTCTCACATTGAACGGGAACAATCTACAGGTCTCTTCAAAGTCAAA
GTTCAGCACAAGAATAAAGGTTTTGAGCGCATATTTACTGTCAAACATGTCGTGCTTGCCCCCGGATTTTCTGGT
GGATCTTGGTATACGCCCACGTATCCGGGAATGGACAAATTCAAAGGACAAATCATTCACTCGTCGGAATACAAG
AAAGCTGAAGATTATTTAGGAAAAAAAGTTATTCTAGTCGGTTCATGCACGTCAGCTCATGACATCGGTATGGAT
CTGTATGATAATGGAATCGATGTGACGATGTATCAGCGCAGTTCTACCCATGTGATTACTGCGCAATCTGTAGTA
AATGTGTTTTTCAAAGGCTTGTTCGATGAGACGGGGCCGCCAATTACTGTAGCTGATAAAGTAGCCGCAACTTTC
CCCAACCTCCTCAACGTCGGGATACATCATAGAGGCACGTTAGCAGCTGAAGAAGCAGAGAAAGAAATGCTAGAC
AACCTTCGTCGCGTTGGTTTCAATCTCAATCGCGGATATAAAGATGCTGGTGTCTTATTAACCGCTTTCACGAGG
GCAGGAGGCTATTACTTGGATGTCGGCGGAAGCCAATATGTCATCGACGGAAAGATTAAATTGAAGAGCAAGAGC
ACTATGGAGGGTTTTACAGAGACGGGCATCAACTTTGCGGACGGGAGCCAACTTGAGGCTGACGTTGTCGTGTTT
TGCACTGGTCTCGGAAGCACTCGTGATGTCATAAAAGCATTTTTAGACCCAAAGACCTTCCAAAACGTGAATGAG
ATATGGGGATACAATAACGAAATGGAGTTCAATGGGATCTATGGGGACACAGGTGTACCAAACCTATGGTACATG
ATGGGTAGTCTCGGTCTTTGCCGCTTTTATTCCAAGCGACTGGCACTTCAAATCAAAGCAATCGAAGAAGGTGTA
TTTGGGGAGCGATACAAGTCAAACGTCAAAGGTTTAAGCTTTTAA
Transcript >AgabiH97|080050
ATGACCACTTCTGCAGCTCATCCTTCTGAAGCGCCCTTGCCCACTCTAAATAAACTCGGTATCTCTTCTCTTCCG
GAGGATATTGATGCTCGAAAGGTAGCAAGCGAGTGGTTTGCATTGTTCGCAGACAAGGTTACCTCAAACGACCCT
GAAGGGATCACGAATCTCCTCGTTCAATCGTCTTTTGACTCTGGCCGTCCTGAGACTGCAGACCAAGTTTCTGTT
TACTGGCGCGACTTACTTGCTCTCACTTGGAATTTCCGTTCTTTCGAGGGCACCACTCAAATTCGCGAGTTTTTG
ACGGATCGTCTTACAAGTGCTAAAATCGCCAACTTGAAGTTGAAGACCTCAGACGATGCAGAAGGATTGGCACCG
GTTTTTGCACGACCAATGCCAGATTTGGTTTGGATTACTGGGTTTTTTACATTCGAAACCGACGTCGGCTTTTGT
TCGGGTATATTCCGACTTGTGCCTACCTTGGATGAGCAGCAACGAGTTCAGTGGAAAGCGCACTGTATCTTCACA
AATTTGGAGGAGTTGAGAGGATTCCCTGAGAAGGTTGGAAATCTGCGTGATCCAACGCCTTATAGCGGAGGATGG
GAAAAGCTTCGAGAGAAAGAGAAGCTATTTGAAGATACCGAACCCACTGTGCTGATTGTGGGAGCTGGTCAAAGC
GGTCTGACAGCTGCAGCAAGATTGAAACTTCTTGGGATATCAAGTGTTTTGATAGAGAAGAATGAAAGAGTAGGA
GATAATTGGAGAAATCGATATGACGTCTTGTGTCTTCATGATCCCGTCTGGTACGACCACATGCCATACATCCCT
TTCCCTGAGAATTGGCCTATCTACTCCCCCTCGAAGAAGCTAGCGAATTGGTTAGAATTTTACGCAGACTCGATG
GAATTAAATGTCTGGACCTCAACAACGGTTTCTCACATTGAACGGGAACAATCTACAGGTCTCTTCAAAGTCAAA
GTTCAGCACAAGAATAAAGGTTTTGAGCGCATATTTACTGTCAAACATGTCGTGCTTGCCCCCGGATTTTCTGGT
GGATCTTGGTATACGCCCACGTATCCGGGAATGGACAAATTCAAAGGACAAATCATTCACTCGTCGGAATACAAG
AAAGCTGAAGATTATTTAGGAAAAAAAGTTATTCTAGTCGGTTCATGCACGTCAGCTCATGACATCGGTATGGAT
CTGTATGATAATGGAATCGATGTGACGATGTATCAGCGCAGTTCTACCCATGTGATTACTGCGCAATCTGTAGTA
AATGTGTTTTTCAAAGGCTTGTTCGATGAGACGGGGCCGCCAATTACTGTAGCTGATAAAGTAGCCGCAACTTTC
CCCAACCTCCTCAACGTCGGGATACATCATAGAGGCACGTTAGCAGCTGAAGAAGCAGAGAAAGAAATGCTAGAC
AACCTTCGTCGCGTTGGTTTCAATCTCAATCGCGGATATAAAGATGCTGGTGTCTTATTAACCGCTTTCACGAGG
GCAGGAGGCTATTACTTGGATGTCGGCGGAAGCCAATATGTCATCGACGGAAAGATTAAATTGAAGAGCAAGAGC
ACTATGGAGGGTTTTACAGAGACGGGCATCAACTTTGCGGACGGGAGCCAACTTGAGGCTGACGTTGTCGTGTTT
TGCACTGGTCTCGGAAGCACTCGTGATGTCATAAAAGCATTTTTAGACCCAAAGACCTTCCAAAACGTGAATGAG
ATATGGGGATACAATAACGAAATGGAGTTCAATGGGATCTATGGGGACACAGGTGTACCAAACCTATGGTACATG
ATGGGTAGTCTCGGTCTTTGCCGCTTTTATTCCAAGCGACTGGCACTTCAAATCAAAGCAATCGAAGAAGGTGTA
TTTGGGGAGCGATACAAGTCAAACGTCAAAGGTTTAAGCTTTTAA
Gene >AgabiH97|080050
ATGACCACTTCTGCAGCTCATCCTTCTGAAGCGCCCTTGCCCACTCTAAATAAACTCGGTATCTCTTCTCTTCCG
GAGGATATTGATGCTCGAAAGGTAGCAAGCGAGTGGTTTGCATTGTTCGCAGACAAGGTTACCTCAAACGACCCT
GAAGGGATCACGAATCTCCTCGTTCAATCGTCTTTTGACTCTGGCCGTCCTGAGACTGCAGACCAAGTTTCTGTT
TACTGGCGCGACTTACTTGCTCTCACTTGGAATTTCCGTTCTTTCGAGGGCACCACTCAAATTCGCGAGTTTTTG
ACGGATCGTCTTACAAGTGCTAAAATCGCCAACTTGAAGTTGAAGACCTCAGACGATGCAGAAGGATTGGCACCG
GTTTTTGCACGACCAATGCCAGATTTGGTTTGGATTACTGGGTTTTTTACATTCGAAACCGACGTCGGCTTTTGT
TCGGGTATATTCCGACTTGTGCCTACCTTGGATGAGCAGCAACGAGTTCAGTGGAAAGCGCACTGTATCTTCACA
AATTTGGAGGAGTTGAGAGGATTCCCTGAGAAGGTTGGAAATCTGCGTGATCCAACGCCTTATAGCGGAGGATGG
GAAAAGCTTCGAGAGAAAGAGAAGCTATTTGAAGATACCGAACCCACTGTGCTGATTGTGGGAGCTGGTCAAAGC
GGTCTGACAGCTGCAGCAAGATTGAAACTTCTTGGGATATCAAGTGTTTTGATAGAGAAGAATGAAAGAGTAGGA
GATAATTGGAGAAATCGATATGACGTCTTGTGTCTTCATGATCCCGTCTGTGAGTGATTAAGATCTGTTATTCGT
ATGTCATCTGAAACTAGTGATAGGGTACGACCACATGCCATACATCCCGTAGGCAACCAAACTTATCTCTCTCGA
TTCTGGATTCATCGAAAGCTTTCATTCAGTTTCCCTGAGAATTGGCCTATCTACTCCCCCTCGAAGAAGGTGGAT
TTTTGTGACCTATATATCATCTAATGAGACGCTAATGGGCACGTATAACTTATCAAGCTAGCGAATTGGTTAGAA
TTTTACGCAGACTCGATGGAATTAAATGTCTGGACCTCAACAACGGTTTCTCACATTGAACGGGAACAATCTACA
GGTCTCTTCAAAGTCAAAGTTCAGCACAAGAATAAAGGTTTTGAGCGCATATTTACTGTCAAACATGTCGTGCTT
GCCCCCGGATTTTCTGGTGGATCTTGGTATACGCCCACGTATCCGGGAATGGTGCTGCAAACATTTAATTGTTTT
CTTCGTGTACTAACATTAACATTAGGACAAATTCAAAGGACAAATCATTCACTCGTCGGAATACAAGAAAGCTGA
AGATTATTTAGGAAAAAAAGTTATTCTAGTCGGTTCATGCACGTCAGGTATGACTATATTTCGCAAAGCGTTGTC
TCTTGGGCCTTATTTTTTTCTCCGTCGCCTGACCAGCTCATGACATCGGTATGGATCTGTATGATAATGGAATCG
GTTTGTGTAACCTGTTCAATTGCTCACGCTAATTATCAACAAGATTGATATAGATGTGACGATGTATCAGCGCAG
TTCTACCCATGTGATTACTGCGCAATCTGTAGTAAATGTGTTTTTCAAAGGTAATAAATGGACATAACCCACAAA
CGTTTCTGACCACTTTCTGATACAGGCTTGTTCGATGAGACGGGGCCGCCAATTACTGTAGCTGATAAAGTAGCC
GCAACTTTCCCCAACCTCCTCAACGTCGGGATACATCATAGAGGCACGTTAGCAGCTGAAGAAGCAGAGAAGTAC
TATTTTATCCCGCGAATGTATACTAGATCTCATATTACACCCTCAGAGAAATGCTAGACAACCTTCGTCGCGTTG
GTTTCAATCTCAATCGCGGATATAAAGATGCTGGTGTCTTATTAACCGCTTTCACGAGGGCAGGAGGCTATTACT
TGGGTACAAGATTCCTCATAACGCTCCTCATTAATTTATATCATTTTTAGATGTCGGCGGAAGCCAATATGTCAT
CGACGGAAAGATTAAATTGAAGAGCAAGAGCACTATGGAGGGTTTTACAGAGACGGGCATCAACTTTGCGGACGG
GAGCCAACTTGAGGCTGACGTTGTCGTGTTTTGCACTGGGTAAAACAATCTCGTCCTCGGATTATGAGTACTAAC
TCCGGTGGTAGTCTCGGAAGCACTCGTGATGTCATAAAAGCATTTTTAGACCCAAAGACCTTCCAAAACGTGAAT
GAGATATGGGGATACAATAACGAAATGGAGTTCAATGGGATCTATGGGGACACAGGTGTACCAAACCTATGGTAC
ATGATGGGTACGATAGGCCATATAACTTTTCGTGGACAAAATTCTGACGCGTATGACTGTTTTCTAGGTAGTCTC
GGTCTTTGCCGCTTTTATTCCAAGCGACTGGCACTTCGTGAGTCAAAAACGTGGCAGCCTTGCTGAGCTCTTGCA
TAACCTAAACAATCTAGAAATCAAAGCAATCGAAGAAGGTGTATTTGGGGAGCGATACAAGTCAAACGTCAAAGG
TTTAAGCTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail