Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079920
Gene name
Locationscaffold_5:458382..462732
Strand+
Gene length (bp)4350
Transcript length (bp)4350
Coding sequence length (bp)4350
Protein length (aa) 1450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 2.5E-50 956 1196
PF13976 gag_pre-integrs GAG-pre-integrase domain 3.1E-14 510 580
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 3.7E-10 94 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 1440 4.0E-179
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 892 1438 5.0E-95
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 399 824 1.0E-40
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1036 1345 5.0E-37
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1120 1348 9.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 1440 4.0E-179
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 892 1438 5.0E-95
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 399 824 1.0E-40
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1036 1345 5.0E-37
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1120 1348 9.0E-34
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 351 788 4.0E-31
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 351 788 4.0E-31
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 351 788 5.0E-31
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 351 788 5.0E-31
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 351 788 5.0E-31
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 351 788 5.0E-31
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 351 788 5.0E-31
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 351 788 5.0E-31
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 351 788 5.0E-31
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 351 788 5.0E-31
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 351 788 6.0E-31
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 351 788 6.0E-31
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 351 788 7.0E-31
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 351 788 7.0E-31
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 351 788 7.0E-31
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 351 788 7.0E-31
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 351 788 1.0E-30
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 351 788 1.0E-30
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 351 788 1.0E-30
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 351 788 1.0E-30
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 351 788 2.0E-30
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 351 788 2.0E-30
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 351 788 2.0E-30
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 351 788 3.0E-30
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 351 788 3.0E-30
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 351 788 4.0E-30
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 351 788 4.0E-30
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 351 788 4.0E-30
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 351 788 5.0E-30
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 376 788 2.0E-29
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 376 788 2.0E-29
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 373 788 3.0E-29
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 438 788 8.0E-27
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 438 788 2.0E-26
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 438 788 2.0E-26
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 438 788 2.0E-26
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 438 788 2.0E-26
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 438 788 2.0E-26
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 438 788 2.0E-26
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 438 788 2.0E-26
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 438 788 2.0E-26
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 438 788 2.0E-26
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 438 788 2.0E-26
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 438 788 2.0E-26
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 431 739 6.0E-21
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 431 739 1.0E-20
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 431 739 1.0E-20
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 889 1424 5.0E-19
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 930 1424 2.0E-18
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 967 1424 2.0E-18
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 889 1424 2.0E-18
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 930 1424 3.0E-18
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 930 1424 3.0E-18
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 967 1424 3.0E-18
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 967 1424 3.0E-18
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 967 1424 3.0E-18
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 967 1424 3.0E-18
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 967 1424 3.0E-18
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 967 1424 5.0E-18
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 967 1424 5.0E-18
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 930 1424 8.0E-18
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 967 1424 9.0E-18
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 930 1424 1.0E-17
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 930 1424 1.0E-17
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 930 1424 1.0E-17
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 930 1424 1.0E-17
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 930 1424 2.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 930 1424 2.0E-17
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 930 1424 2.0E-17
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 930 1424 2.0E-17
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 548 788 2.0E-17
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 930 1424 4.0E-17
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 930 1424 4.0E-17
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 930 1424 4.0E-17
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 930 1424 5.0E-17
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 930 1424 5.0E-17
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 930 1424 5.0E-17
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 930 1424 7.0E-17
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 930 1424 8.0E-17
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 930 1424 9.0E-17
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 930 1424 9.0E-17
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 930 1424 2.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 931 1425 2.0E-16
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 931 1425 2.0E-16
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 930 1424 3.0E-16
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 930 1424 4.0E-16
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 930 1424 4.0E-16
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 930 1424 5.0E-16
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 930 1424 7.0E-16
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 930 1424 1.0E-15
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 930 1424 4.0E-15
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 930 1424 4.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 930 1424 4.0E-15
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 928 1026 2.0E-11
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1230 1307 7.0E-09
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 707 814 3.0E-08
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 930 1284 8.0E-08
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 572 741 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079920
MATNTGGSAPPIFADTAKFDGTNWVSWSGMIRIAAELRGVFGYLDGSIINPAITPPTIPAGPAATPSPPTITITP
PSSTTETPWESTTPHAPEWKVRNAWAKGLLIYNTTDPVGLGISIGGTAADAWKSYIDNYEVASEIALLNAEMELR
NITYSDGQNFTEFISRIRTKWSNANALGASIDDKSFRTIILNALPRSWDSIVATLYTTKTSRDAISQLLTHWARI
SRDRVTTSQTTSALQATTQSGNRDRQRSQNSQLVCTNQNCNRRGHTIEFCYWPGGGKAGQFPPGFGRRGGARGNA
NNTATGGYQTSANATTTTENGEKKEEKVFALAAITDEPEDVKVPPETPIHPSTPNTSPIPSVSNSLRVDASNGQG
ELDVGIRITSSTSETTSPNDMITLLDSGASDHCFVNRNSFSTYNSIIPPRQGNSAGKGSTFRINGAGDAELHTSL
NGVPTKIMFAGALHTPDLRSNLISVSKLVSRGASVNFEGNRAVVRNGAGNVAIVAVKENGLYVIPSNNVYANAVQ
SKRKGVPLEIWHRRLGHINVEVVKRMLKDNLVDGLNVTGAMEMESLCEDCIFGKHTAHPYNNPSPPESEVLQRVY
IDIWGPSPVQSAGGAKYFMLVMDGATSYRKIYFLTTKSAEMTLTAFKEYHREAERQTGKKLKEVRADMGREWHNE
LWSTYVKENGIVLNFTTPYAHQQNGKAERSMRTLLDMARTMLADSGLPQKYWADAVQTAAYVRNLTPTANDLTVI
PAQRWSGQRQDVSHLRPFGSTAYAHIPTEISPSKLSPRSSKLTLVGYYGHTGYKLLDRTTGAAYKSRDVIFEETR
PHFSTDPSPSFQVDESHASNPSSAFAPRPKPITTLHDHSTITPQPVDDEPAAVAEGVVSPELPLALRRGRREIKP
SQRMRDTLEYLGRPVAHVAALSEDLLVPKTYCEAMKKPELWLDPMLKELQVMKDKEVFRLVSRPVDKNVVRSRWV
FANKYDEAGDVVSQKARLVAKGFTQVLGEDYDETYASVARLESVRLVCAIAAARGLRLWQVDFVSAFLNSENSYE
VYMEQPPGFEEGGDNVWLLLKTLYGTMQGAHDWAQTLDRTYAGHGYYTSLADPQIRSRVEDDELTLTSTWTDDVL
GASSTMEGEVKAKDELGKSYEIKDLGTARFILGMKIERGEDGSVRISQRAYCERTIERFKLSDLKPRSTPLPTGT
ILSIEDSPTSDEEKADMANVPYREVLGSLMWLQVATRPDLSFAVNLLSRFANNPGRAHWDAMKHTMAYVKATMDY
GITYHHGTSIQPLGFVDADFAGDTDARRSTEGHVFFVAGGPVSWASKRQDTVALSTVEAEYMAFSRAVQQAVWLT
TFMGEVGLPREEPILIYADNNGAIANTLNFKNHRRTKHIDIRYHFVKEKTANGEVVFEYIPSSENLADIFTKPLA
RDAVIRCCDGMGLRSVEAGGVLGL*
Coding >AgabiH97|079920
ATGGCTACAAACACAGGGGGTAGCGCCCCACCCATATTTGCTGATACTGCGAAATTTGATGGCACAAACTGGGTG
TCATGGAGTGGAATGATTCGTATTGCTGCAGAGTTGCGAGGAGTATTTGGCTACCTCGATGGTTCAATTATCAAC
CCAGCTATCACCCCTCCTACTATACCAGCTGGACCAGCTGCGACTCCATCCCCGCCGACCATTACTATTACTCCA
CCATCTTCAACCACAGAGACACCATGGGAGTCTACTACTCCACACGCCCCCGAATGGAAAGTGCGTAACGCCTGG
GCCAAAGGTCTTCTCATCTACAATACCACCGATCCCGTTGGTCTTGGTATATCCATTGGGGGAACCGCAGCCGAT
GCCTGGAAGTCATACATCGACAACTACGAGGTGGCTTCCGAGATCGCTCTCCTTAATGCTGAAATGGAATTGAGG
AACATAACATATAGTGATGGACAAAACTTTACCGAGTTCATTTCACGTATCAGAACCAAATGGTCCAATGCAAAT
GCTCTTGGAGCGAGTATAGACGACAAATCCTTCCGTACCATCATCTTGAATGCACTTCCTCGTTCTTGGGACTCC
ATTGTCGCCACTTTATACACCACCAAGACCTCTCGGGACGCTATAAGTCAACTCCTGACCCATTGGGCTCGTATC
AGCAGAGACCGTGTCACTACATCGCAGACAACCTCAGCACTTCAGGCTACCACCCAATCTGGCAATCGCGACCGT
CAGCGCTCCCAAAATAGCCAACTCGTCTGTACCAATCAAAATTGCAACCGGCGAGGACATACAATTGAATTTTGT
TACTGGCCGGGTGGAGGAAAAGCTGGTCAGTTCCCACCAGGCTTTGGAAGACGTGGAGGAGCTAGGGGAAATGCC
AATAACACTGCGACCGGGGGGTATCAGACATCAGCGAACGCAACTACCACAACCGAGAACGGCGAGAAGAAGGAA
GAAAAGGTCTTCGCCCTTGCTGCTATTACGGACGAACCTGAAGATGTTAAGGTACCACCCGAAACCCCCATACAT
CCCAGCACTCCTAACACCTCTCCAATCCCTAGTGTCTCTAATTCCTTACGCGTTGACGCTAGTAACGGACAAGGG
GAGCTGGACGTTGGCATTAGGATTACGTCGAGTACATCTGAAACTACCTCACCAAATGATATGATTACTTTGCTC
GACTCTGGAGCGAGCGATCATTGCTTCGTGAATAGAAACTCCTTTTCTACATACAACTCGATAATTCCCCCTCGC
CAGGGAAATTCTGCAGGAAAGGGATCGACGTTTAGGATTAACGGAGCTGGAGATGCCGAGTTACACACATCACTG
AATGGCGTACCGACGAAGATCATGTTCGCGGGCGCATTACACACCCCAGATCTGAGGAGCAACCTCATTTCAGTT
TCTAAACTAGTTTCAAGGGGGGCATCGGTTAATTTCGAGGGGAATAGAGCCGTTGTTCGTAATGGTGCTGGAAAT
GTGGCGATTGTGGCAGTCAAGGAGAATGGCCTGTATGTCATACCGTCAAACAATGTATATGCAAACGCAGTCCAA
TCGAAAAGGAAGGGCGTACCGTTAGAAATATGGCACCGGCGTTTAGGCCACATTAATGTCGAGGTGGTGAAGAGG
ATGCTGAAAGATAATCTCGTGGATGGATTGAACGTCACTGGAGCGATGGAGATGGAGAGCCTTTGCGAGGACTGC
ATCTTCGGTAAACATACTGCTCATCCCTACAACAACCCTTCACCACCCGAGAGCGAAGTACTACAACGAGTATAT
ATCGACATATGGGGACCATCCCCAGTCCAGTCAGCTGGGGGAGCTAAGTATTTTATGCTTGTCATGGACGGCGCC
ACATCCTATAGGAAAATATACTTCCTCACCACTAAGTCTGCTGAGATGACGTTGACGGCGTTCAAGGAATACCAC
AGGGAGGCAGAGAGACAAACGGGCAAGAAGTTGAAGGAGGTGCGAGCGGACATGGGAAGAGAGTGGCACAACGAA
TTGTGGAGTACGTACGTAAAAGAGAACGGCATCGTTCTCAACTTCACCACCCCCTACGCACACCAACAGAATGGG
AAGGCAGAACGATCCATGCGTACGCTGCTGGACATGGCACGTACTATGCTAGCGGATTCTGGTCTACCCCAGAAG
TACTGGGCTGACGCTGTCCAAACCGCCGCATATGTGAGGAACCTCACTCCTACTGCGAACGACCTCACTGTTATC
CCCGCTCAACGCTGGTCTGGTCAACGACAGGACGTCTCTCACCTCAGACCTTTCGGTTCAACTGCTTATGCGCAC
ATACCCACTGAGATTAGTCCTTCGAAATTGTCTCCTCGTTCATCCAAGCTTACACTGGTTGGATACTATGGACAT
ACAGGTTATAAGCTACTCGATCGTACCACCGGCGCTGCCTACAAGTCGAGGGATGTCATCTTTGAAGAGACACGT
CCACACTTCTCAACCGACCCTTCCCCATCCTTCCAAGTTGACGAATCTCATGCCTCAAACCCTTCGAGCGCATTT
GCGCCACGCCCAAAGCCTATTACCACCCTACATGACCATTCCACAATCACGCCACAACCCGTCGACGACGAACCT
GCTGCTGTGGCGGAAGGTGTTGTCTCGCCGGAGTTACCTCTTGCTTTGAGGAGGGGACGCCGAGAGATAAAGCCG
TCCCAACGCATGAGGGACACTCTGGAGTACTTGGGGCGTCCAGTAGCCCATGTTGCGGCATTATCAGAGGACCTT
CTCGTGCCGAAGACCTACTGTGAAGCTATGAAGAAACCAGAGTTGTGGCTTGATCCGATGTTGAAGGAGCTGCAG
GTCATGAAGGACAAAGAGGTTTTCCGGCTAGTATCTCGTCCTGTCGACAAGAATGTAGTCAGGTCGAGGTGGGTT
TTTGCCAACAAATACGATGAGGCGGGTGACGTTGTTAGCCAGAAGGCTCGTTTAGTCGCTAAGGGCTTCACACAG
GTCCTGGGGGAGGACTATGACGAGACATATGCATCGGTGGCACGTTTGGAATCTGTCCGACTCGTGTGCGCTATT
GCTGCAGCGCGGGGCCTCCGTCTGTGGCAGGTGGATTTTGTGTCGGCTTTCCTGAATAGTGAGAACTCGTACGAG
GTTTACATGGAGCAGCCGCCTGGTTTTGAGGAGGGGGGAGATAACGTCTGGTTACTCCTCAAAACATTGTATGGC
ACTATGCAAGGCGCACACGACTGGGCGCAAACGCTCGACCGAACCTACGCAGGACACGGTTACTATACGTCCTTA
GCCGACCCACAGATACGATCAAGGGTTGAAGACGATGAACTAACTCTGACTTCAACTTGGACAGACGATGTACTC
GGCGCTTCATCTACAATGGAGGGTGAGGTTAAGGCGAAGGATGAATTGGGAAAGAGCTATGAGATCAAGGACTTG
GGGACGGCAAGGTTTATATTGGGGATGAAAATTGAGAGAGGGGAAGATGGCAGTGTCAGGATATCACAACGGGCT
TATTGCGAACGAACTATTGAACGTTTCAAACTTTCCGACTTGAAACCTCGTTCGACTCCCCTACCCACAGGTACA
ATACTCTCAATTGAAGACTCGCCGACGTCCGATGAGGAAAAGGCTGACATGGCGAACGTTCCGTACAGGGAAGTA
CTTGGTTCTCTGATGTGGCTCCAAGTCGCTACACGCCCAGACCTTTCCTTCGCTGTCAACCTATTATCCCGTTTT
GCGAATAATCCCGGCCGCGCTCATTGGGATGCGATGAAGCATACTATGGCTTATGTCAAAGCAACGATGGACTAT
GGCATCACTTACCATCATGGAACAAGCATTCAGCCTTTGGGTTTCGTCGATGCAGACTTTGCGGGTGACACGGAT
GCTCGACGCTCAACTGAAGGACATGTTTTCTTTGTGGCGGGGGGACCTGTGTCTTGGGCAAGCAAGCGTCAAGAT
ACTGTCGCCCTATCGACTGTTGAGGCTGAGTATATGGCTTTTAGCCGTGCTGTCCAACAGGCTGTTTGGCTGACG
ACTTTTATGGGAGAGGTGGGATTGCCTCGAGAGGAACCTATCTTGATCTATGCCGACAATAATGGAGCCATTGCC
AATACGCTAAACTTCAAAAACCACCGACGCACGAAACACATTGACATCCGGTATCATTTTGTTAAAGAAAAGACG
GCGAATGGAGAAGTTGTTTTCGAGTATATTCCTTCGTCGGAGAACTTAGCCGATATTTTTACCAAGCCACTTGCT
CGCGACGCTGTCATACGATGCTGTGATGGTATGGGTCTTCGGAGTGTCGAAGCAGGGGGAGTATTGGGATTGTGA
Transcript >AgabiH97|079920
ATGGCTACAAACACAGGGGGTAGCGCCCCACCCATATTTGCTGATACTGCGAAATTTGATGGCACAAACTGGGTG
TCATGGAGTGGAATGATTCGTATTGCTGCAGAGTTGCGAGGAGTATTTGGCTACCTCGATGGTTCAATTATCAAC
CCAGCTATCACCCCTCCTACTATACCAGCTGGACCAGCTGCGACTCCATCCCCGCCGACCATTACTATTACTCCA
CCATCTTCAACCACAGAGACACCATGGGAGTCTACTACTCCACACGCCCCCGAATGGAAAGTGCGTAACGCCTGG
GCCAAAGGTCTTCTCATCTACAATACCACCGATCCCGTTGGTCTTGGTATATCCATTGGGGGAACCGCAGCCGAT
GCCTGGAAGTCATACATCGACAACTACGAGGTGGCTTCCGAGATCGCTCTCCTTAATGCTGAAATGGAATTGAGG
AACATAACATATAGTGATGGACAAAACTTTACCGAGTTCATTTCACGTATCAGAACCAAATGGTCCAATGCAAAT
GCTCTTGGAGCGAGTATAGACGACAAATCCTTCCGTACCATCATCTTGAATGCACTTCCTCGTTCTTGGGACTCC
ATTGTCGCCACTTTATACACCACCAAGACCTCTCGGGACGCTATAAGTCAACTCCTGACCCATTGGGCTCGTATC
AGCAGAGACCGTGTCACTACATCGCAGACAACCTCAGCACTTCAGGCTACCACCCAATCTGGCAATCGCGACCGT
CAGCGCTCCCAAAATAGCCAACTCGTCTGTACCAATCAAAATTGCAACCGGCGAGGACATACAATTGAATTTTGT
TACTGGCCGGGTGGAGGAAAAGCTGGTCAGTTCCCACCAGGCTTTGGAAGACGTGGAGGAGCTAGGGGAAATGCC
AATAACACTGCGACCGGGGGGTATCAGACATCAGCGAACGCAACTACCACAACCGAGAACGGCGAGAAGAAGGAA
GAAAAGGTCTTCGCCCTTGCTGCTATTACGGACGAACCTGAAGATGTTAAGGTACCACCCGAAACCCCCATACAT
CCCAGCACTCCTAACACCTCTCCAATCCCTAGTGTCTCTAATTCCTTACGCGTTGACGCTAGTAACGGACAAGGG
GAGCTGGACGTTGGCATTAGGATTACGTCGAGTACATCTGAAACTACCTCACCAAATGATATGATTACTTTGCTC
GACTCTGGAGCGAGCGATCATTGCTTCGTGAATAGAAACTCCTTTTCTACATACAACTCGATAATTCCCCCTCGC
CAGGGAAATTCTGCAGGAAAGGGATCGACGTTTAGGATTAACGGAGCTGGAGATGCCGAGTTACACACATCACTG
AATGGCGTACCGACGAAGATCATGTTCGCGGGCGCATTACACACCCCAGATCTGAGGAGCAACCTCATTTCAGTT
TCTAAACTAGTTTCAAGGGGGGCATCGGTTAATTTCGAGGGGAATAGAGCCGTTGTTCGTAATGGTGCTGGAAAT
GTGGCGATTGTGGCAGTCAAGGAGAATGGCCTGTATGTCATACCGTCAAACAATGTATATGCAAACGCAGTCCAA
TCGAAAAGGAAGGGCGTACCGTTAGAAATATGGCACCGGCGTTTAGGCCACATTAATGTCGAGGTGGTGAAGAGG
ATGCTGAAAGATAATCTCGTGGATGGATTGAACGTCACTGGAGCGATGGAGATGGAGAGCCTTTGCGAGGACTGC
ATCTTCGGTAAACATACTGCTCATCCCTACAACAACCCTTCACCACCCGAGAGCGAAGTACTACAACGAGTATAT
ATCGACATATGGGGACCATCCCCAGTCCAGTCAGCTGGGGGAGCTAAGTATTTTATGCTTGTCATGGACGGCGCC
ACATCCTATAGGAAAATATACTTCCTCACCACTAAGTCTGCTGAGATGACGTTGACGGCGTTCAAGGAATACCAC
AGGGAGGCAGAGAGACAAACGGGCAAGAAGTTGAAGGAGGTGCGAGCGGACATGGGAAGAGAGTGGCACAACGAA
TTGTGGAGTACGTACGTAAAAGAGAACGGCATCGTTCTCAACTTCACCACCCCCTACGCACACCAACAGAATGGG
AAGGCAGAACGATCCATGCGTACGCTGCTGGACATGGCACGTACTATGCTAGCGGATTCTGGTCTACCCCAGAAG
TACTGGGCTGACGCTGTCCAAACCGCCGCATATGTGAGGAACCTCACTCCTACTGCGAACGACCTCACTGTTATC
CCCGCTCAACGCTGGTCTGGTCAACGACAGGACGTCTCTCACCTCAGACCTTTCGGTTCAACTGCTTATGCGCAC
ATACCCACTGAGATTAGTCCTTCGAAATTGTCTCCTCGTTCATCCAAGCTTACACTGGTTGGATACTATGGACAT
ACAGGTTATAAGCTACTCGATCGTACCACCGGCGCTGCCTACAAGTCGAGGGATGTCATCTTTGAAGAGACACGT
CCACACTTCTCAACCGACCCTTCCCCATCCTTCCAAGTTGACGAATCTCATGCCTCAAACCCTTCGAGCGCATTT
GCGCCACGCCCAAAGCCTATTACCACCCTACATGACCATTCCACAATCACGCCACAACCCGTCGACGACGAACCT
GCTGCTGTGGCGGAAGGTGTTGTCTCGCCGGAGTTACCTCTTGCTTTGAGGAGGGGACGCCGAGAGATAAAGCCG
TCCCAACGCATGAGGGACACTCTGGAGTACTTGGGGCGTCCAGTAGCCCATGTTGCGGCATTATCAGAGGACCTT
CTCGTGCCGAAGACCTACTGTGAAGCTATGAAGAAACCAGAGTTGTGGCTTGATCCGATGTTGAAGGAGCTGCAG
GTCATGAAGGACAAAGAGGTTTTCCGGCTAGTATCTCGTCCTGTCGACAAGAATGTAGTCAGGTCGAGGTGGGTT
TTTGCCAACAAATACGATGAGGCGGGTGACGTTGTTAGCCAGAAGGCTCGTTTAGTCGCTAAGGGCTTCACACAG
GTCCTGGGGGAGGACTATGACGAGACATATGCATCGGTGGCACGTTTGGAATCTGTCCGACTCGTGTGCGCTATT
GCTGCAGCGCGGGGCCTCCGTCTGTGGCAGGTGGATTTTGTGTCGGCTTTCCTGAATAGTGAGAACTCGTACGAG
GTTTACATGGAGCAGCCGCCTGGTTTTGAGGAGGGGGGAGATAACGTCTGGTTACTCCTCAAAACATTGTATGGC
ACTATGCAAGGCGCACACGACTGGGCGCAAACGCTCGACCGAACCTACGCAGGACACGGTTACTATACGTCCTTA
GCCGACCCACAGATACGATCAAGGGTTGAAGACGATGAACTAACTCTGACTTCAACTTGGACAGACGATGTACTC
GGCGCTTCATCTACAATGGAGGGTGAGGTTAAGGCGAAGGATGAATTGGGAAAGAGCTATGAGATCAAGGACTTG
GGGACGGCAAGGTTTATATTGGGGATGAAAATTGAGAGAGGGGAAGATGGCAGTGTCAGGATATCACAACGGGCT
TATTGCGAACGAACTATTGAACGTTTCAAACTTTCCGACTTGAAACCTCGTTCGACTCCCCTACCCACAGGTACA
ATACTCTCAATTGAAGACTCGCCGACGTCCGATGAGGAAAAGGCTGACATGGCGAACGTTCCGTACAGGGAAGTA
CTTGGTTCTCTGATGTGGCTCCAAGTCGCTACACGCCCAGACCTTTCCTTCGCTGTCAACCTATTATCCCGTTTT
GCGAATAATCCCGGCCGCGCTCATTGGGATGCGATGAAGCATACTATGGCTTATGTCAAAGCAACGATGGACTAT
GGCATCACTTACCATCATGGAACAAGCATTCAGCCTTTGGGTTTCGTCGATGCAGACTTTGCGGGTGACACGGAT
GCTCGACGCTCAACTGAAGGACATGTTTTCTTTGTGGCGGGGGGACCTGTGTCTTGGGCAAGCAAGCGTCAAGAT
ACTGTCGCCCTATCGACTGTTGAGGCTGAGTATATGGCTTTTAGCCGTGCTGTCCAACAGGCTGTTTGGCTGACG
ACTTTTATGGGAGAGGTGGGATTGCCTCGAGAGGAACCTATCTTGATCTATGCCGACAATAATGGAGCCATTGCC
AATACGCTAAACTTCAAAAACCACCGACGCACGAAACACATTGACATCCGGTATCATTTTGTTAAAGAAAAGACG
GCGAATGGAGAAGTTGTTTTCGAGTATATTCCTTCGTCGGAGAACTTAGCCGATATTTTTACCAAGCCACTTGCT
CGCGACGCTGTCATACGATGCTGTGATGGTATGGGTCTTCGGAGTGTCGAAGCAGGGGGAGTATTGGGATTGTGA
Gene >AgabiH97|079920
ATGGCTACAAACACAGGGGGTAGCGCCCCACCCATATTTGCTGATACTGCGAAATTTGATGGCACAAACTGGGTG
TCATGGAGTGGAATGATTCGTATTGCTGCAGAGTTGCGAGGAGTATTTGGCTACCTCGATGGTTCAATTATCAAC
CCAGCTATCACCCCTCCTACTATACCAGCTGGACCAGCTGCGACTCCATCCCCGCCGACCATTACTATTACTCCA
CCATCTTCAACCACAGAGACACCATGGGAGTCTACTACTCCACACGCCCCCGAATGGAAAGTGCGTAACGCCTGG
GCCAAAGGTCTTCTCATCTACAATACCACCGATCCCGTTGGTCTTGGTATATCCATTGGGGGAACCGCAGCCGAT
GCCTGGAAGTCATACATCGACAACTACGAGGTGGCTTCCGAGATCGCTCTCCTTAATGCTGAAATGGAATTGAGG
AACATAACATATAGTGATGGACAAAACTTTACCGAGTTCATTTCACGTATCAGAACCAAATGGTCCAATGCAAAT
GCTCTTGGAGCGAGTATAGACGACAAATCCTTCCGTACCATCATCTTGAATGCACTTCCTCGTTCTTGGGACTCC
ATTGTCGCCACTTTATACACCACCAAGACCTCTCGGGACGCTATAAGTCAACTCCTGACCCATTGGGCTCGTATC
AGCAGAGACCGTGTCACTACATCGCAGACAACCTCAGCACTTCAGGCTACCACCCAATCTGGCAATCGCGACCGT
CAGCGCTCCCAAAATAGCCAACTCGTCTGTACCAATCAAAATTGCAACCGGCGAGGACATACAATTGAATTTTGT
TACTGGCCGGGTGGAGGAAAAGCTGGTCAGTTCCCACCAGGCTTTGGAAGACGTGGAGGAGCTAGGGGAAATGCC
AATAACACTGCGACCGGGGGGTATCAGACATCAGCGAACGCAACTACCACAACCGAGAACGGCGAGAAGAAGGAA
GAAAAGGTCTTCGCCCTTGCTGCTATTACGGACGAACCTGAAGATGTTAAGGTACCACCCGAAACCCCCATACAT
CCCAGCACTCCTAACACCTCTCCAATCCCTAGTGTCTCTAATTCCTTACGCGTTGACGCTAGTAACGGACAAGGG
GAGCTGGACGTTGGCATTAGGATTACGTCGAGTACATCTGAAACTACCTCACCAAATGATATGATTACTTTGCTC
GACTCTGGAGCGAGCGATCATTGCTTCGTGAATAGAAACTCCTTTTCTACATACAACTCGATAATTCCCCCTCGC
CAGGGAAATTCTGCAGGAAAGGGATCGACGTTTAGGATTAACGGAGCTGGAGATGCCGAGTTACACACATCACTG
AATGGCGTACCGACGAAGATCATGTTCGCGGGCGCATTACACACCCCAGATCTGAGGAGCAACCTCATTTCAGTT
TCTAAACTAGTTTCAAGGGGGGCATCGGTTAATTTCGAGGGGAATAGAGCCGTTGTTCGTAATGGTGCTGGAAAT
GTGGCGATTGTGGCAGTCAAGGAGAATGGCCTGTATGTCATACCGTCAAACAATGTATATGCAAACGCAGTCCAA
TCGAAAAGGAAGGGCGTACCGTTAGAAATATGGCACCGGCGTTTAGGCCACATTAATGTCGAGGTGGTGAAGAGG
ATGCTGAAAGATAATCTCGTGGATGGATTGAACGTCACTGGAGCGATGGAGATGGAGAGCCTTTGCGAGGACTGC
ATCTTCGGTAAACATACTGCTCATCCCTACAACAACCCTTCACCACCCGAGAGCGAAGTACTACAACGAGTATAT
ATCGACATATGGGGACCATCCCCAGTCCAGTCAGCTGGGGGAGCTAAGTATTTTATGCTTGTCATGGACGGCGCC
ACATCCTATAGGAAAATATACTTCCTCACCACTAAGTCTGCTGAGATGACGTTGACGGCGTTCAAGGAATACCAC
AGGGAGGCAGAGAGACAAACGGGCAAGAAGTTGAAGGAGGTGCGAGCGGACATGGGAAGAGAGTGGCACAACGAA
TTGTGGAGTACGTACGTAAAAGAGAACGGCATCGTTCTCAACTTCACCACCCCCTACGCACACCAACAGAATGGG
AAGGCAGAACGATCCATGCGTACGCTGCTGGACATGGCACGTACTATGCTAGCGGATTCTGGTCTACCCCAGAAG
TACTGGGCTGACGCTGTCCAAACCGCCGCATATGTGAGGAACCTCACTCCTACTGCGAACGACCTCACTGTTATC
CCCGCTCAACGCTGGTCTGGTCAACGACAGGACGTCTCTCACCTCAGACCTTTCGGTTCAACTGCTTATGCGCAC
ATACCCACTGAGATTAGTCCTTCGAAATTGTCTCCTCGTTCATCCAAGCTTACACTGGTTGGATACTATGGACAT
ACAGGTTATAAGCTACTCGATCGTACCACCGGCGCTGCCTACAAGTCGAGGGATGTCATCTTTGAAGAGACACGT
CCACACTTCTCAACCGACCCTTCCCCATCCTTCCAAGTTGACGAATCTCATGCCTCAAACCCTTCGAGCGCATTT
GCGCCACGCCCAAAGCCTATTACCACCCTACATGACCATTCCACAATCACGCCACAACCCGTCGACGACGAACCT
GCTGCTGTGGCGGAAGGTGTTGTCTCGCCGGAGTTACCTCTTGCTTTGAGGAGGGGACGCCGAGAGATAAAGCCG
TCCCAACGCATGAGGGACACTCTGGAGTACTTGGGGCGTCCAGTAGCCCATGTTGCGGCATTATCAGAGGACCTT
CTCGTGCCGAAGACCTACTGTGAAGCTATGAAGAAACCAGAGTTGTGGCTTGATCCGATGTTGAAGGAGCTGCAG
GTCATGAAGGACAAAGAGGTTTTCCGGCTAGTATCTCGTCCTGTCGACAAGAATGTAGTCAGGTCGAGGTGGGTT
TTTGCCAACAAATACGATGAGGCGGGTGACGTTGTTAGCCAGAAGGCTCGTTTAGTCGCTAAGGGCTTCACACAG
GTCCTGGGGGAGGACTATGACGAGACATATGCATCGGTGGCACGTTTGGAATCTGTCCGACTCGTGTGCGCTATT
GCTGCAGCGCGGGGCCTCCGTCTGTGGCAGGTGGATTTTGTGTCGGCTTTCCTGAATAGTGAGAACTCGTACGAG
GTTTACATGGAGCAGCCGCCTGGTTTTGAGGAGGGGGGAGATAACGTCTGGTTACTCCTCAAAACATTGTATGGC
ACTATGCAAGGCGCACACGACTGGGCGCAAACGCTCGACCGAACCTACGCAGGACACGGTTACTATACGTCCTTA
GCCGACCCACAGATACGATCAAGGGTTGAAGACGATGAACTAACTCTGACTTCAACTTGGACAGACGATGTACTC
GGCGCTTCATCTACAATGGAGGGTGAGGTTAAGGCGAAGGATGAATTGGGAAAGAGCTATGAGATCAAGGACTTG
GGGACGGCAAGGTTTATATTGGGGATGAAAATTGAGAGAGGGGAAGATGGCAGTGTCAGGATATCACAACGGGCT
TATTGCGAACGAACTATTGAACGTTTCAAACTTTCCGACTTGAAACCTCGTTCGACTCCCCTACCCACAGGTACA
ATACTCTCAATTGAAGACTCGCCGACGTCCGATGAGGAAAAGGCTGACATGGCGAACGTTCCGTACAGGGAAGTA
CTTGGTTCTCTGATGTGGCTCCAAGTCGCTACACGCCCAGACCTTTCCTTCGCTGTCAACCTATTATCCCGTTTT
GCGAATAATCCCGGCCGCGCTCATTGGGATGCGATGAAGCATACTATGGCTTATGTCAAAGCAACGATGGACTAT
GGCATCACTTACCATCATGGAACAAGCATTCAGCCTTTGGGTTTCGTCGATGCAGACTTTGCGGGTGACACGGAT
GCTCGACGCTCAACTGAAGGACATGTTTTCTTTGTGGCGGGGGGACCTGTGTCTTGGGCAAGCAAGCGTCAAGAT
ACTGTCGCCCTATCGACTGTTGAGGCTGAGTATATGGCTTTTAGCCGTGCTGTCCAACAGGCTGTTTGGCTGACG
ACTTTTATGGGAGAGGTGGGATTGCCTCGAGAGGAACCTATCTTGATCTATGCCGACAATAATGGAGCCATTGCC
AATACGCTAAACTTCAAAAACCACCGACGCACGAAACACATTGACATCCGGTATCATTTTGTTAAAGAAAAGACG
GCGAATGGAGAAGTTGTTTTCGAGTATATTCCTTCGTCGGAGAACTTAGCCGATATTTTTACCAAGCCACTTGCT
CGCGACGCTGTCATACGATGCTGTGATGGTATGGGTCTTCGGAGTGTCGAAGCAGGGGGAGTATTGGGATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail