Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079850
Gene name
Locationscaffold_5:440426..441861
Strand-
Gene length (bp)1435
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 7.6E-51 136 324
PF03936 Terpene_synth_C Terpene synthase family, metal binding domain 7.4E-07 200 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 52 386 3.0E-113
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 68 390 3.0E-44
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 62 392 6.0E-42
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 74 370 6.0E-34
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 63 394 9.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 52 386 3.0E-113
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 68 390 3.0E-44
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 62 392 6.0E-42
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 74 370 6.0E-34
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 63 394 9.0E-31
sp|B5GS26|DCADS_STRC2 (-)-delta-cadinene synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=SCreLAV_p0328 PE=1 SV=1 81 370 1.0E-20
sp|D8RLD3|MTS17_SELML (+)-germacrene D synthase OS=Selaginella moellendorffii GN=SELMODRAFT_412756 PE=1 SV=1 81 370 2.0E-19
sp|J9R1J8|MTS1_SELML Microbial Terpene synthase-like protein 1 OS=Selaginella moellendorffii GN=SELMODRAFT_402353 PE=1 SV=2 114 370 6.0E-17
sp|Q82RR7|TPC1_STRAW Avermitilol synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tpc1 PE=1 SV=1 186 370 7.0E-16
sp|J9R393|MTS13_SELML Microbial Terpene synthase-like protein 13 OS=Selaginella moellendorffii GN=SELMODRAFT_412537 PE=2 SV=2 75 374 9.0E-14
sp|Q9X839|CYC2_STRCO Germacradienol/geosmin synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc2 PE=1 SV=3 65 373 2.0E-13
sp|E3VWJ0|PNTA_STRAE Pentalenene synthase OS=Streptomyces arenae GN=pntA PE=3 SV=1 74 370 4.0E-13
sp|Q82IY4|PTLA_STRAW Pentalenene synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlA PE=1 SV=1 74 370 8.0E-13
sp|Q55012|PENA_STREX Pentalenene synthase OS=Streptomyces exfoliatus GN=penA PE=1 SV=4 74 370 1.0E-12
sp|Q9X839|CYC2_STRCO Germacradienol/geosmin synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc2 PE=1 SV=3 186 370 2.0E-11
sp|Q9K499|CYC1_STRCO Epi-isozizaene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc1 PE=1 SV=1 44 363 1.0E-10
sp|B1W019|GCOA_STRGG (+)-caryolan-1-ol synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gcoA PE=1 SV=1 189 374 5.0E-10
sp|Q9F1V8|MIBS_STRGR 2-methylisoborneol synthase OS=Streptomyces griseus PE=3 SV=1 85 374 2.0E-09
sp|J9QS25|MTS26_SELML (E)-2-epi-beta-caryophyllene synthase OS=Selaginella moellendorffii GN=SELMODRAFT_414574 PE=1 SV=2 75 375 1.0E-07
sp|A4FG19|MIBS_SACEN 2-methylisoborneol synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_3722 PE=1 SV=1 181 370 5.0E-07
sp|A1C8C3|OPHFS_ASPCL Ophiobolin F synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_076850 PE=1 SV=1 122 370 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0010333 terpene synthase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0016829 lyase activity Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079850
MDCLPVPSTQCQGTILHGPFRILTTSFILFKSKSCSSLAFVAATMPNQMVFSPSSFSKRNDTPDHFILPDLVGHC
SYTVRLNPNCDRMARQSEKWLLKLAKHPRAKQIKFLGLKAGELTAACYPDTDGFRLRVCDDFMNYLFNLDDWLDD
FDVNDTYGMRNCCIGAMQDPQSFQTKKRAGRLTKHFFKRFAKGAGPGCRERFIHSMDLFFTAVATQSRDRADGIT
PDLESYITVRRDTSGCKPCFQLIEFAGDFDLPDEVVNHELIQNLEEATNDLVTWSNDIFSYNKEQKYHDTHNMIT
VVMNQYGFTLQQAVDFVGFKCKKSIENFEYDRNRLPSWGIEIDRMVEKYVDGLQNWIVGSLHWSFDTERYFSKDG
HQIKKHRLVKLSPKVPLVVFQA*
Coding >AgabiH97|079850
ATGGACTGTTTGCCCGTTCCGTCAACTCAATGCCAAGGAACAATACTTCACGGACCCTTTAGAATCTTAACAACA
TCATTCATTCTTTTTAAGTCGAAGTCTTGCTCTTCTCTCGCATTCGTCGCCGCAACAATGCCCAACCAGATGGTC
TTCTCCCCTTCCTCGTTCTCCAAGAGGAATGACACTCCCGACCACTTTATCCTCCCAGACCTCGTCGGTCATTGT
TCCTATACCGTACGTCTCAACCCCAACTGCGATCGCATGGCCCGGCAGTCTGAGAAATGGCTTCTCAAACTCGCT
AAACACCCCCGGGCTAAGCAAATCAAGTTTCTGGGTCTCAAAGCCGGCGAACTCACTGCGGCTTGTTATCCCGAT
ACCGACGGTTTCCGTCTTCGCGTATGCGATGACTTCATGAACTACTTGTTCAATCTTGACGACTGGCTGGATGAT
TTTGATGTCAACGACACCTATGGTATGAGGAATTGTTGCATCGGCGCTATGCAGGACCCGCAAAGTTTCCAGACG
AAGAAGAGGGCTGGTCGATTGACCAAACATTTTTTCAAACGATTTGCCAAGGGTGCCGGTCCCGGCTGCCGTGAG
AGATTCATCCATAGTATGGATCTCTTTTTTACCGCCGTGGCCACACAATCCCGAGACCGTGCGGACGGTATTACT
CCCGATCTCGAATCTTACATCACCGTGCGTAGGGATACGAGTGGTTGTAAACCCTGTTTCCAACTTATCGAATTC
GCCGGAGACTTCGACTTGCCCGATGAAGTTGTCAATCACGAGTTGATTCAAAATTTGGAAGAAGCGACCAACGAC
CTCGTTACTTGGTCCAATGATATTTTCTCGTACAACAAAGAGCAAAAGTACCATGACACTCACAACATGATCACT
GTCGTTATGAATCAATACGGATTCACACTCCAACAAGCCGTCGACTTTGTCGGATTCAAATGCAAGAAGAGTATC
GAAAACTTTGAATATGACCGAAATCGCCTTCCTTCTTGGGGTATCGAGATCGACCGCATGGTCGAGAAGTACGTT
GATGGTTTGCAAAATTGGATCGTTGGATCTTTGCATTGGTCTTTTGATACCGAAAGGTACTTTTCCAAGGACGGT
CACCAAATCAAGAAGCATAGACTCGTAAAGCTCTCGCCAAAGGTTCCCCTTGTCGTTTTTCAGGCTTGA
Transcript >AgabiH97|079850
ATGGACTGTTTGCCCGTTCCGTCAACTCAATGCCAAGGAACAATACTTCACGGACCCTTTAGAATCTTAACAACA
TCATTCATTCTTTTTAAGTCGAAGTCTTGCTCTTCTCTCGCATTCGTCGCCGCAACAATGCCCAACCAGATGGTC
TTCTCCCCTTCCTCGTTCTCCAAGAGGAATGACACTCCCGACCACTTTATCCTCCCAGACCTCGTCGGTCATTGT
TCCTATACCGTACGTCTCAACCCCAACTGCGATCGCATGGCCCGGCAGTCTGAGAAATGGCTTCTCAAACTCGCT
AAACACCCCCGGGCTAAGCAAATCAAGTTTCTGGGTCTCAAAGCCGGCGAACTCACTGCGGCTTGTTATCCCGAT
ACCGACGGTTTCCGTCTTCGCGTATGCGATGACTTCATGAACTACTTGTTCAATCTTGACGACTGGCTGGATGAT
TTTGATGTCAACGACACCTATGGTATGAGGAATTGTTGCATCGGCGCTATGCAGGACCCGCAAAGTTTCCAGACG
AAGAAGAGGGCTGGTCGATTGACCAAACATTTTTTCAAACGATTTGCCAAGGGTGCCGGTCCCGGCTGCCGTGAG
AGATTCATCCATAGTATGGATCTCTTTTTTACCGCCGTGGCCACACAATCCCGAGACCGTGCGGACGGTATTACT
CCCGATCTCGAATCTTACATCACCGTGCGTAGGGATACGAGTGGTTGTAAACCCTGTTTCCAACTTATCGAATTC
GCCGGAGACTTCGACTTGCCCGATGAAGTTGTCAATCACGAGTTGATTCAAAATTTGGAAGAAGCGACCAACGAC
CTCGTTACTTGGTCCAATGATATTTTCTCGTACAACAAAGAGCAAAAGTACCATGACACTCACAACATGATCACT
GTCGTTATGAATCAATACGGATTCACACTCCAACAAGCCGTCGACTTTGTCGGATTCAAATGCAAGAAGAGTATC
GAAAACTTTGAATATGACCGAAATCGCCTTCCTTCTTGGGGTATCGAGATCGACCGCATGGTCGAGAAGTACGTT
GATGGTTTGCAAAATTGGATCGTTGGATCTTTGCATTGGTCTTTTGATACCGAAAGGTACTTTTCCAAGGACGGT
CACCAAATCAAGAAGCATAGACTCGTAAAGCTCTCGCCAAAGGTTCCCCTTGTCGTTTTTCAGGCTTGA
Gene >AgabiH97|079850
ATGGACTGTTTGCCCGTTCCGTCAACTCAATGCCAAGGAACAATACTTCACGGACCCTTTAGAATCTTAACAACA
TCATTCATTCTTTTTAAGGTATGTTCCGTTGGCGAAACCGAAAATATATAAACCCTTGGAACAAATCCGAACCCG
CAGTCGAAGTCTTGCTCTTCTCTCGCATTCGTCGCCGCAACAATGCCCAACCAGATGGTCTTCTCCCCTTCCTCG
TTCTCCAAGAGGAATGACACTCCCGACCACTTTATCCTCCCAGACCTCGTCGGTCATTGTTCCTATACCGTACGT
CTCAACCCCAACTGCGATCGCATGGCCCGGCAGTCTGAGAAATGGCTTCTCAAACTCGCTAAACACCCCCGGGCT
AAGCAAATCAAGTTTCTGGGTCTCAAAGCCGGCGAACTCACTGCGGCTTGTTATCCCGATACCGACGGTTTCCGT
CTTCGCGTATGCGATGACTTCATGAACTACTTGTTCAATCTTGACGACTGGCTGGATGATTTTGATGTCAACGAC
ACCTATGGTATGAGGAATTGTTGCATCGGCGCTATGCAGGACCCGCAAAGTTTCCAGACGAAGAAGAGGGCTGGT
CGATTGACCAAACAGTACGAAATTACATTCTTAATCTCCTCATCTTTCATTTAATTAACTGTCACCATTCTAGTT
TTTTCAAACGATTTGCCAAGGGTGCCGGTCCCGGCTGCCGTGAGAGATTCATCCATAGTATGGATCTCTTTTTTA
CCGCCGTGGCCACACAATCCCGAGACCGTGCGGACGGTATTACTCCCGATCTCGAATCTTACATCACCGTGCGTA
GGGATACGAGTGGTTGTAAACCCTGTTTCCAACTTATCGAATTCGCCGGAGACTTCGACTTGCCCGATGAAGTTG
TCAATCACGAGTTGATTCAAAATTTGGAAGAAGCGACCAACGACCTCGTTACTTGGTCCAATGTAAGAACCATTC
CTTTCCCATACGTCTGCGAATTATTCACGATATGTCTCCTTTCTGCATAGGATATTTTCTCGTACAACAAAGAGC
AAAAGTACCATGACACTCACAACATGATCACTGTCGTTATGAATCAATACGGATTCACACTCCAACAAGCCGTCG
ACTTTGTCGGATTCAAATGCAAGAAGAGTATCGAAAACTTTGAATATGACCGAAATCGCCTTCCTTCTTGGGGTA
TCGAGATCGACCGCATGGTCGAGAAGTACGTTGATGGTTTGCAAAATTGGATCGTTGGTCTGTTACGTTTCCATG
TTAATGACATTCTCCCGACTCACTCGGACTGCTTTTTTTAGGATCTTTGCATTGGTCTTTTGATACCGAAAGGTA
CTTTTCCAAGGACGGTCACCAAATCAAGAAGCATAGACTCGTAAAGCTCTCGCCAAAGGTTCCCCTTGTCGTTTT
TCAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail