Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079720
Gene name
Locationscaffold_5:409545..411976
Strand+
Gene length (bp)2431
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 4.1E-92 28 525
PF20434 BD-FAE BD-FAE 2.6E-14 107 218
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 6.4E-08 124 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 2 540 1.0E-62
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 48 515 1.0E-60
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 48 514 5.0E-60
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 44 535 5.0E-59
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 44 535 5.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 2 540 1.0E-62
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 48 515 1.0E-60
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 48 514 5.0E-60
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 44 535 5.0E-59
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 44 535 5.0E-59
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 48 433 2.0E-58
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 48 521 1.0E-57
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 44 535 7.0E-57
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 48 515 2.0E-54
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 2 511 3.0E-45
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 28 525 1.0E-44
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 44 509 1.0E-44
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 7 510 5.0E-44
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 47 310 3.0E-43
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 8 297 2.0E-42
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 20 510 6.0E-42
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 19 306 1.0E-41
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 10 511 2.0E-41
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 47 515 1.0E-40
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 35 305 2.0E-40
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 23 523 2.0E-40
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 20 515 2.0E-40
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 1 496 2.0E-40
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 27 523 3.0E-40
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 20 515 4.0E-40
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 7 515 4.0E-40
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 7 305 4.0E-40
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 27 523 5.0E-40
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 24 471 6.0E-40
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 2 539 6.0E-40
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 47 523 9.0E-40
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 35 539 1.0E-39
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 20 515 1.0E-39
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 1 283 2.0E-39
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 28 537 2.0E-39
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 47 523 2.0E-39
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 28 537 2.0E-39
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 21 297 2.0E-39
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 25 508 5.0E-39
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 5 327 6.0E-39
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 35 296 9.0E-39
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 47 515 2.0E-38
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 35 283 2.0E-38
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 47 293 4.0E-38
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 26 248 1.0E-37
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 25 510 1.0E-37
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 1 293 1.0E-37
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 9 353 5.0E-37
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 47 523 7.0E-37
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 29 502 7.0E-37
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 21 243 8.0E-37
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 35 303 1.0E-36
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 7 289 1.0E-36
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 47 293 2.0E-36
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 35 302 2.0E-36
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 47 294 2.0E-36
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 7 289 2.0E-36
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 4 541 3.0E-36
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 45 292 3.0E-36
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 11 241 3.0E-36
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 47 515 5.0E-36
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 1 282 5.0E-36
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 19 375 5.0E-36
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 4 511 7.0E-36
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 1 282 1.0E-35
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 45 292 1.0E-35
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 35 511 1.0E-35
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 29 347 2.0E-35
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 9 353 2.0E-35
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 36 302 2.0E-34
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 8 346 6.0E-34
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 1 284 2.0E-33
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 7 294 2.0E-33
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 26 520 2.0E-33
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 29 290 3.0E-33
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 29 305 5.0E-33
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 1 482 1.0E-32
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 52 250 1.0E-32
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 99 346 1.0E-32
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 42 283 2.0E-32
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 47 511 2.0E-32
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 8 346 3.0E-32
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 4 310 3.0E-32
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 1 490 7.0E-32
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 30 243 8.0E-32
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 52 291 9.0E-32
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 5 292 1.0E-31
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 1 522 1.0E-31
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 47 445 1.0E-31
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 1 479 1.0E-31
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 8 346 2.0E-31
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 7 468 3.0E-31
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 5 294 3.0E-31
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 47 445 4.0E-31
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 47 445 4.0E-31
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 7 468 5.0E-31
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 5 517 8.0E-31
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 6 353 1.0E-30
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 7 468 3.0E-30
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 47 353 8.0E-30
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 47 513 8.0E-30
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 47 353 1.0E-29
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 11 524 3.0E-29
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 26 243 9.0E-29
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 48 310 1.0E-28
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 3 297 2.0E-28
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 10 353 2.0E-28
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 3 492 7.0E-28
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 3 495 2.0E-27
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 4 502 3.0E-27
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 47 243 4.0E-27
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 102 294 6.0E-27
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 100 225 3.0E-26
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 52 502 3.0E-26
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 100 225 9.0E-26
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 100 225 1.0E-25
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 8 353 2.0E-25
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 52 502 3.0E-25
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 47 353 3.0E-25
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 100 225 6.0E-25
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 47 241 2.0E-24
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 102 293 4.0E-24
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 31 507 6.0E-24
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 43 310 6.0E-24
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 43 305 5.0E-23
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 43 310 3.0E-22
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 34 247 1.0E-21
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 123 289 1.0E-21
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 2 468 5.0E-21
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 28 253 6.0E-20
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 2 201 7.0E-20
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 47 310 3.0E-19
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 46 310 1.0E-18
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 47 255 2.0E-18
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 111 297 1.0E-16
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 2 289 2.0E-16
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 47 244 3.0E-16
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 45 169 8.0E-15
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 45 169 8.0E-15
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 45 169 8.0E-15
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 107 218 4.0E-09
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 107 218 4.0E-09
sp|Q94AS5|ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Arabidopsis thaliana GN=ICME PE=2 SV=1 107 233 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 10.27 4.76 15.79
Initials Initials knots 5.94 2.82 9.06
Pileal_Stipeal_center Stage I stipe center 3.44 1.49 5.38
Pileal_Stipeal_shell Stage I stipe shell 4.91 2.25 7.56
DIF_stipe_center Stage II stipe center 2.75 1.15 4.36
DIF_stipe_shell Stage II stipe shell 3.77 1.67 5.87
DIF_stipe_skin Stage II stipe skin 4.05 1.75 6.36
DIF_cap_skin Stage II cap skin 4.50 2.05 6.95
DIF_cap_tissue Stage II cap tissue 3.97 1.77 6.17
DIF_gill_tissue Stage II gill tissue 4.66 2.14 7.19
YFB_stipe_center Young fruiting body stipe center 2.24 0.90 3.59
YFB_stipe_shell Young fruiting body stipe shell 2.45 0.99 3.90
YFB_stipe_skin Young fruiting body stipe skin 3.65 1.58 5.71
YFB_cap_skin Young fruiting body cap skin 3.90 1.73 6.07
YFB_cap_tissue Young fruiting body cap tissue 4.18 1.88 6.47
YFB_gill_tissue Young fruiting body gill tissue 3.64 1.58 5.69
YFB_veil Young fruiting body veil 4.20 1.90 6.50

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.026955 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.004160 yes
Casing YFB_cap_skin 0.004548 yes
Casing YFB_cap_tissue 0.010093 yes
Casing YFB_gill_tissue 0.003765 yes
Casing YFB_veil 0.014956 yes
Casing Initials 0.146718 no
Casing Pileal_Stipeal_center 0.004548 yes
Casing Pileal_Stipeal_shell 0.042041 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.002951 yes
Casing DIF_stipe_skin 0.010093 yes
Casing DIF_cap_skin 0.021322 yes
Casing DIF_cap_tissue 0.007782 yes
DIF_gill_tissue YFB_stipe_center 0.059318 no
DIF_gill_tissue YFB_stipe_shell 0.105377 no
DIF_gill_tissue YFB_stipe_skin 0.646578 no
DIF_gill_tissue YFB_cap_skin 0.755051 no
DIF_gill_tissue YFB_cap_tissue 0.867760 no
DIF_gill_tissue YFB_gill_tissue 0.641080 no
DIF_gill_tissue YFB_veil 0.873402 no
YFB_stipe_center YFB_stipe_shell 0.910118 no
YFB_stipe_center YFB_stipe_skin 0.279664 no
YFB_stipe_center YFB_cap_skin 0.191804 no
YFB_stipe_center YFB_cap_tissue 0.130962 no
YFB_stipe_center YFB_gill_tissue 0.287292 no
YFB_stipe_center YFB_veil 0.126905 no
YFB_stipe_shell YFB_stipe_skin 0.407913 no
YFB_stipe_shell YFB_cap_skin 0.296217 no
YFB_stipe_shell YFB_cap_tissue 0.215281 no
YFB_stipe_shell YFB_gill_tissue 0.413186 no
YFB_stipe_shell YFB_veil 0.210195 no
YFB_stipe_skin YFB_cap_skin 0.928471 no
YFB_stipe_skin YFB_cap_tissue 0.835219 no
YFB_stipe_skin YFB_gill_tissue 0.994762 no
YFB_stipe_skin YFB_veil 0.827041 no
YFB_cap_skin YFB_cap_tissue 0.922276 no
YFB_cap_skin YFB_gill_tissue 0.923568 no
YFB_cap_skin YFB_veil 0.916270 no
YFB_cap_tissue YFB_gill_tissue 0.828369 no
YFB_cap_tissue YFB_veil 0.994680 no
YFB_gill_tissue YFB_veil 0.821681 no
Initials DIF_gill_tissue 0.632284 no
Initials YFB_stipe_center 0.004160 yes
Initials YFB_stipe_shell 0.015819 yes
Initials YFB_stipe_skin 0.228362 no
Initials YFB_cap_skin 0.306617 no
Initials YFB_cap_tissue 0.435938 no
Initials YFB_gill_tissue 0.225814 no
Initials YFB_veil 0.440104 no
Initials Pileal_Stipeal_center 0.161964 no
Initials Pileal_Stipeal_shell 0.728168 no
Initials DIF_stipe_center 0.034142 yes
Initials DIF_stipe_shell 0.265551 no
Initials DIF_stipe_skin 0.394341 no
Initials DIF_cap_skin 0.565926 no
Initials DIF_cap_tissue 0.344220 no
Pileal_Stipeal_center DIF_gill_tissue 0.544449 no
Pileal_Stipeal_center YFB_stipe_center 0.366713 no
Pileal_Stipeal_center YFB_stipe_shell 0.510519 no
Pileal_Stipeal_center YFB_stipe_skin 0.936767 no
Pileal_Stipeal_center YFB_cap_skin 0.851914 no
Pileal_Stipeal_center YFB_cap_tissue 0.741355 no
Pileal_Stipeal_center YFB_gill_tissue 0.942014 no
Pileal_Stipeal_center YFB_veil 0.731202 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.453844 no
Pileal_Stipeal_center DIF_stipe_center 0.712070 no
Pileal_Stipeal_center DIF_stipe_shell 0.894880 no
Pileal_Stipeal_center DIF_stipe_skin 0.794716 no
Pileal_Stipeal_center DIF_cap_skin 0.610529 no
Pileal_Stipeal_center DIF_cap_tissue 0.822107 no
Pileal_Stipeal_shell DIF_gill_tissue 0.944777 no
Pileal_Stipeal_shell YFB_stipe_center 0.042475 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.082806 no
Pileal_Stipeal_shell YFB_stipe_skin 0.558591 no
Pileal_Stipeal_shell YFB_cap_skin 0.665514 no
Pileal_Stipeal_shell YFB_cap_tissue 0.789401 no
Pileal_Stipeal_shell YFB_gill_tissue 0.552797 no
Pileal_Stipeal_shell YFB_veil 0.796435 no
Pileal_Stipeal_shell DIF_stipe_center 0.161304 no
Pileal_Stipeal_shell DIF_stipe_shell 0.613748 no
Pileal_Stipeal_shell DIF_stipe_skin 0.744692 no
Pileal_Stipeal_shell DIF_cap_skin 0.898530 no
Pileal_Stipeal_shell DIF_cap_tissue 0.702496 no
DIF_stipe_center DIF_gill_tissue 0.204349 no
DIF_stipe_center YFB_stipe_center 0.741726 no
DIF_stipe_center YFB_stipe_shell 0.870058 no
DIF_stipe_center YFB_stipe_skin 0.596653 no
DIF_stipe_center YFB_cap_skin 0.469557 no
DIF_stipe_center YFB_cap_tissue 0.355101 no
DIF_stipe_center YFB_gill_tissue 0.605922 no
DIF_stipe_center YFB_veil 0.349727 no
DIF_stipe_center DIF_stipe_shell 0.530541 no
DIF_stipe_center DIF_stipe_skin 0.417769 no
DIF_stipe_center DIF_cap_skin 0.255478 no
DIF_stipe_center DIF_cap_tissue 0.437800 no
DIF_stipe_shell DIF_gill_tissue 0.695138 no
DIF_stipe_shell YFB_stipe_center 0.221487 no
DIF_stipe_shell YFB_stipe_shell 0.345557 no
DIF_stipe_shell YFB_stipe_skin 0.963168 no
DIF_stipe_shell YFB_cap_skin 0.965330 no
DIF_stipe_shell YFB_cap_tissue 0.877317 no
DIF_stipe_shell YFB_gill_tissue 0.959964 no
DIF_stipe_shell YFB_veil 0.870058 no
DIF_stipe_shell DIF_stipe_skin 0.919571 no
DIF_stipe_shell DIF_cap_skin 0.762490 no
DIF_stipe_shell DIF_cap_tissue 0.943748 no
DIF_stipe_skin DIF_gill_tissue 0.821698 no
DIF_stipe_skin YFB_stipe_center 0.152465 no
DIF_stipe_skin YFB_stipe_shell 0.252511 no
DIF_stipe_skin YFB_stipe_skin 0.876270 no
DIF_stipe_skin YFB_cap_skin 0.958020 no
DIF_stipe_skin YFB_cap_tissue 0.968363 no
DIF_stipe_skin YFB_gill_tissue 0.870930 no
DIF_stipe_skin YFB_veil 0.963168 no
DIF_stipe_skin DIF_cap_skin 0.876641 no
DIF_stipe_skin DIF_cap_tissue 0.978263 no
DIF_cap_skin DIF_gill_tissue 0.960344 no
DIF_cap_skin YFB_stipe_center 0.077698 no
DIF_cap_skin YFB_stipe_shell 0.142080 no
DIF_cap_skin YFB_stipe_skin 0.712150 no
DIF_cap_skin YFB_cap_skin 0.818827 no
DIF_cap_skin YFB_cap_tissue 0.918318 no
DIF_cap_skin YFB_gill_tissue 0.708234 no
DIF_cap_skin YFB_veil 0.923737 no
DIF_cap_skin DIF_cap_tissue 0.848502 no
DIF_cap_tissue DIF_gill_tissue 0.787480 no
DIF_cap_tissue YFB_stipe_center 0.167499 no
DIF_cap_tissue YFB_stipe_shell 0.272837 no
DIF_cap_tissue YFB_stipe_skin 0.902848 no
DIF_cap_tissue YFB_cap_skin 0.979377 no
DIF_cap_tissue YFB_cap_tissue 0.946416 no
DIF_cap_tissue YFB_gill_tissue 0.897078 no
DIF_cap_tissue YFB_veil 0.941167 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079720
MVLLRPLLNCLLAFTALTKGSPARNDKLEIQLSTGTFRGFSPAESRIEQWFGIPFAEPPVGPLRFKAPIPIKGEP
GVVKDATQFGGACPQMDAEGAGAPVSEDCLYMNVYRPSEASSHKKLPVLVWIHGGQWTTGAGSRYDPTEIVRRSV
FNKKPIVFVSVNYRLNTFGFLASAHQPPEDLNAGLLDQRLALEFIQDNIAAFGGDPDKVTIWGQSAGGGSVAAHF
IYPSEKTLFRAGIGQSATGPFKSSPPPSVYDKPGKSFDRLLSSTGCHESTAPVDCLRDVPFETLLNISNSMIDNT
LNGQLWEPTIGPEGSMAMATEQASSKVMRGDFLHLPYLGSTTLNEGTDFTESLQNLNLTGQAQNSRLDDYIRALL
IDGTTLTQDVLDEIHELYKENDTSLGGPFNTGDPLFDRASAFYTDEMFLGPRRLFFQHGSDLQPMFAYHFTEFIP
GNEIELGVTHATDLHLLLGFRTAPEATPPPIEHDFANEMKDIWINFVNDLNPGENWPRFDNTAEKPVMQLQRGNS
TLIPDDFDMERTDFVNTARVLGEFQK*
Coding >AgabiH97|079720
ATGGTGCTCTTACGACCGTTACTCAACTGCCTCCTGGCATTCACGGCTCTCACTAAAGGCTCTCCTGCGAGAAAT
GACAAACTCGAGATACAACTCTCCACGGGAACCTTCCGTGGTTTCTCACCTGCTGAATCTCGTATAGAACAATGG
TTTGGTATACCTTTCGCAGAACCACCTGTTGGTCCATTGCGCTTCAAAGCTCCGATCCCAATCAAAGGCGAGCCT
GGTGTGGTTAAGGATGCGACGCAATTCGGCGGTGCTTGTCCTCAAATGGACGCTGAGGGTGCTGGTGCGCCCGTT
AGTGAGGATTGCTTGTATATGAATGTGTATCGCCCTAGCGAAGCGTCTTCCCATAAGAAGCTACCAGTTTTGGTT
TGGATTCACGGCGGTCAATGGACTACCGGTGCTGGATCACGATATGACCCAACGGAAATTGTGCGAAGGAGCGTT
TTTAATAAAAAGCCAATCGTCTTCGTCTCCGTAAACTACCGCCTCAACACATTCGGATTCCTTGCCAGTGCTCAC
CAACCACCTGAAGATCTTAATGCTGGTCTTCTTGATCAACGTCTTGCTCTGGAGTTCATTCAGGATAATATTGCT
GCGTTTGGCGGTGATCCTGATAAAGTCACTATATGGGGTCAAAGTGCTGGAGGCGGGAGCGTCGCGGCTCATTTC
ATTTACCCATCGGAAAAGACTCTATTTCGTGCGGGAATAGGTCAATCTGCAACCGGGCCGTTTAAGAGTTCTCCG
CCGCCATCAGTATATGATAAGCCTGGTAAATCGTTCGATCGATTGCTGTCTTCTACTGGATGCCACGAAAGCACT
GCTCCTGTAGATTGCCTCCGTGATGTTCCTTTTGAAACTCTCCTGAACATCAGCAACTCCATGATTGACAATACT
TTGAACGGTCAGTTATGGGAGCCAACAATTGGTCCGGAAGGAAGTATGGCAATGGCGACGGAACAAGCTTCGAGC
AAAGTCATGCGAGGTGATTTTTTGCATCTTCCCTACCTCGGTAGCACCACGCTCAATGAGGGGACGGACTTCACC
GAATCCTTACAAAATCTCAATCTAACGGGTCAAGCACAAAATTCAAGATTAGACGACTACATACGAGCGCTCCTC
ATCGACGGGACCACACTCACTCAGGATGTCCTTGATGAAATCCATGAGTTATACAAAGAGAACGATACTTCTCTT
GGCGGCCCGTTTAATACTGGAGACCCATTGTTTGATAGGGCATCGGCGTTTTACACTGATGAAATGTTCTTGGGG
CCGAGGAGACTGTTTTTCCAACATGGCTCGGATCTACAACCGATGTTTGCGTATCACTTTACGGAATTTATTCCG
GGGAATGAAATTGAATTGGGAGTGACGCATGCTACAGATTTGCACTTGCTGCTCGGATTCCGAACTGCTCCCGAG
GCAACTCCCCCACCCATTGAGCACGATTTTGCGAATGAAATGAAGGATATCTGGATAAATTTCGTTAATGACCTT
AATCCTGGTGAAAACTGGCCGCGATTCGATAATACTGCCGAGAAGCCAGTAATGCAATTGCAACGAGGCAATTCA
ACACTTATTCCTGACGATTTTGACATGGAGAGGACTGATTTCGTTAACACGGCGCGCGTACTGGGTGAGTTCCAG
AAGTAG
Transcript >AgabiH97|079720
ATGGTGCTCTTACGACCGTTACTCAACTGCCTCCTGGCATTCACGGCTCTCACTAAAGGCTCTCCTGCGAGAAAT
GACAAACTCGAGATACAACTCTCCACGGGAACCTTCCGTGGTTTCTCACCTGCTGAATCTCGTATAGAACAATGG
TTTGGTATACCTTTCGCAGAACCACCTGTTGGTCCATTGCGCTTCAAAGCTCCGATCCCAATCAAAGGCGAGCCT
GGTGTGGTTAAGGATGCGACGCAATTCGGCGGTGCTTGTCCTCAAATGGACGCTGAGGGTGCTGGTGCGCCCGTT
AGTGAGGATTGCTTGTATATGAATGTGTATCGCCCTAGCGAAGCGTCTTCCCATAAGAAGCTACCAGTTTTGGTT
TGGATTCACGGCGGTCAATGGACTACCGGTGCTGGATCACGATATGACCCAACGGAAATTGTGCGAAGGAGCGTT
TTTAATAAAAAGCCAATCGTCTTCGTCTCCGTAAACTACCGCCTCAACACATTCGGATTCCTTGCCAGTGCTCAC
CAACCACCTGAAGATCTTAATGCTGGTCTTCTTGATCAACGTCTTGCTCTGGAGTTCATTCAGGATAATATTGCT
GCGTTTGGCGGTGATCCTGATAAAGTCACTATATGGGGTCAAAGTGCTGGAGGCGGGAGCGTCGCGGCTCATTTC
ATTTACCCATCGGAAAAGACTCTATTTCGTGCGGGAATAGGTCAATCTGCAACCGGGCCGTTTAAGAGTTCTCCG
CCGCCATCAGTATATGATAAGCCTGGTAAATCGTTCGATCGATTGCTGTCTTCTACTGGATGCCACGAAAGCACT
GCTCCTGTAGATTGCCTCCGTGATGTTCCTTTTGAAACTCTCCTGAACATCAGCAACTCCATGATTGACAATACT
TTGAACGGTCAGTTATGGGAGCCAACAATTGGTCCGGAAGGAAGTATGGCAATGGCGACGGAACAAGCTTCGAGC
AAAGTCATGCGAGGTGATTTTTTGCATCTTCCCTACCTCGGTAGCACCACGCTCAATGAGGGGACGGACTTCACC
GAATCCTTACAAAATCTCAATCTAACGGGTCAAGCACAAAATTCAAGATTAGACGACTACATACGAGCGCTCCTC
ATCGACGGGACCACACTCACTCAGGATGTCCTTGATGAAATCCATGAGTTATACAAAGAGAACGATACTTCTCTT
GGCGGCCCGTTTAATACTGGAGACCCATTGTTTGATAGGGCATCGGCGTTTTACACTGATGAAATGTTCTTGGGG
CCGAGGAGACTGTTTTTCCAACATGGCTCGGATCTACAACCGATGTTTGCGTATCACTTTACGGAATTTATTCCG
GGGAATGAAATTGAATTGGGAGTGACGCATGCTACAGATTTGCACTTGCTGCTCGGATTCCGAACTGCTCCCGAG
GCAACTCCCCCACCCATTGAGCACGATTTTGCGAATGAAATGAAGGATATCTGGATAAATTTCGTTAATGACCTT
AATCCTGGTGAAAACTGGCCGCGATTCGATAATACTGCCGAGAAGCCAGTAATGCAATTGCAACGAGGCAATTCA
ACACTTATTCCTGACGATTTTGACATGGAGAGGACTGATTTCGTTAACACGGCGCGCGTACTGGGTGAGTTCCAG
AAGTAG
Gene >AgabiH97|079720
ATGGTGCTCTTACGACCGTTACTCAACTGCCTCCTGGCATTCACGGCTCTCACTAAAGGCTCTCCTGCGAGAAAT
GACAAACTCGAGATACAACTCTCCACGGGAACCTTCCGTGGTTTCTCACCTGCTGAATCTCGTATAGAACAATGG
TTTGGTATACCTTTCGCAGAACCACCTGTTGGTCCATTGCGCTTCAAAGCTCCGATCCCAATCAAAGGCGAGCCT
GGTGTGGTTAAGGATGCGACGCAATTCGGCGGTGCTTGTCCTCAAATGGACGCTGAGGGTGCTGGTGCGCCCGTT
AGTGAGGATTGCTTGTATATGAATGTAAATCATCATATTCCTTCGAGGTAATCGTGTGAGCTGATGTTATTTGGT
TTTTATCAAAGGTGTATCGCCCTAGCGAAGCGTCTTCCCATAAGAAGCTACCAGTTTTGGTTTGGATTCACGTAC
GCCTTACCTCCCCAGATATCCCCAGATTCGCTGCTAAAATTGGTTGTTTTATCAGGGCGGTCAATGGACTACCGG
GTAAGTAGTATCATGTGTTTTCTTCAATTAAAACCTTCTCACGATATAGGTAGTGCTGGATCACGATATGACCCA
ACGGGTGAGCGAATTCGTGATGTGCTTACATGAGAAGGATATTCAACTGCCCTCCATTCAGAAATTGTGCGAAGG
AGCGTTTTTAATAAAAAGCCAATCGTCTTCGTCTCCGTGTACGTCATCATCTTTGTTCTACAATGACGAGACATA
CCAACCTTTAAACACCAGAAACTACCGCCTCAACACATTCGGATTCGTTAGTATTCGCTATCTACTTTTATAATT
CCATGAGACGAAATACTTCACTTTAGCTTGCCAGTGCTCACCAACCACCTGAAGATCTTAATGCTGGTCTTCTTG
ATCAACGTCTTGCTCTGGAGTTCATTCAGGATAATATTGCTGCGTTTGGCGGTGATCCTGATAAAGTGAGCTCCT
GTTATCGTCTTGTAATTCCCCGTGGCTGAAGACCGGTATTTCAGGTCACTATATGGGGTCAAGTGAGGGAACAGA
ACACACGAATTTTTTCTCCAATTAACCTCTGATTGTTTGAATAGAGTGCTGGAGGCGGGAGCGTCGCGGCTCATT
TCATTTACCCATCGGAAAAGACTCTATTTCGTGCGGGAATAGGTCAATCTGCAACCGGGCCGTTGTATGTGTATC
CTGAAGTATCCGGTGACATCAGATATTGACGGCACTTTGATAGTAAGAGTTCTCCGCCGCCATCAGTATATGATA
AGCCTGGTAAATCGTTCGATCGATTGCTGTCTTCTACTGGATGCCACGAAAGCACTGCTCCTGTAGATTGCCTCC
GTGATGTTCCTTTTGAAGTGAGTTCTCCCCTATACCCAAAAACGATAAATGTCTTGATGTTGTTTGCAGACTCTC
CTGAACATCAGCAACTCCATGATTGACAATACTTTGAACGGTCAGTTATGGGAGCCAACAATTGGTCCGGAAGGA
AGTATGGCAATGGCGACGGAACAAGCTTCGAGCAAAGTCATGCGAGGTGATTTTTTGCATCTTCCCTACCTCGGT
AGCACCACGGTATGTAGCCTACATCTTTCACACACTATCTGACTTACGCATTACTGTTCTCAGCTCAATGAGGGG
ACGGACTTCACCGAATCCTTACAAAATCTCAATCTAACGGGTCAAGCACAAAATTCAAGATTAGACGACTACATA
CGAGCGCTCCTCATCGACGGGACCACACTCACTCAGGATGTCCTTGATGAAATCCATGAGTTATACAAAGAGAAC
GATACTTCTCTTGGCGGCCCGTTTAATACTGGAGACCCATTGTTTGATAGGGCATCGGCGTTTTACACTGATGAA
ATGTTCTTGGGGCCGAGGAGACTGTTTTTCCAACATGGCTCGGATCTACAACCGATGTTTGCGTATCACTTTACG
GAATTTATTCCGGGGAATGAAATTGAATTGGGAGGTAAGTTCTGTTTATAGTATAGAATATGGAGATGATCTGAG
GGTATTTTTCTCGTTTAGTGACGCATGCTACAGATTTGCACTTGCTGCTCGGATTCCGAACTGCTCCCGAGGCAA
CTCCCCCACCCATTGAGCACGATTTTGCGAATGAAATGAAGGATATCTGGATAAATTTCGTTAATGACCTTAATC
CTGGTGGTATGTCCCCCCACACATCATTCAAATCATCCTTGGTACCTACGTCTTATGCCAGAAAACTGGCCGCGA
TTCGATAATACTGCCGAGAAGCCAGTAATGCAATTGCAACGAGGCAATTCAACACTTATTCCTGACGGTATGGAA
TATTCTATCTCTGTTTGACCAATTGATTGATAGCGGTACAGATTTTGACATGGAGAGGACTGATTTCGTTAACAC
GGCGCGCGTACTGGGTGAGTTCCAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail