Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079710
Gene name
Locationscaffold_5:406411..409192
Strand+
Gene length (bp)2781
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 1.0E-90 146 629
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.5E-10 251 375
PF20434 BD-FAE BD-FAE 5.4E-08 243 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 166 627 1.0E-45
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 166 627 2.0E-45
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 166 644 3.0E-45
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 168 621 3.0E-45
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 166 627 3.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 166 627 1.0E-45
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 166 627 2.0E-45
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 166 644 3.0E-45
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 168 621 3.0E-45
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 166 627 3.0E-45
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 166 644 3.0E-45
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 153 628 4.0E-45
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 168 628 2.0E-44
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 166 627 2.0E-44
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 165 627 1.0E-43
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 166 612 1.0E-42
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 166 627 1.0E-42
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 153 637 3.0E-42
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 166 644 3.0E-42
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 129 637 3.0E-42
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 166 612 4.0E-42
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 124 637 1.0E-41
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 166 627 1.0E-41
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 124 637 1.0E-41
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 168 628 5.0E-41
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 147 637 9.0E-41
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 147 502 2.0E-40
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 143 626 3.0E-40
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 124 637 3.0E-40
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 142 637 4.0E-40
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 166 621 8.0E-40
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 166 632 1.0E-39
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 122 632 2.0E-39
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 166 633 4.0E-39
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 166 613 5.0E-39
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 169 465 6.0E-39
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 150 621 7.0E-39
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 166 626 7.0E-39
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 166 632 1.0E-38
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 169 636 2.0E-38
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 124 620 2.0E-38
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 204 637 2.0E-38
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 147 502 2.0E-38
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 166 632 3.0E-38
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 166 632 3.0E-38
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 166 612 6.0E-38
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 165 465 7.0E-38
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 168 478 8.0E-38
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 166 632 1.0E-37
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 169 621 2.0E-37
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 147 616 2.0E-37
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 166 634 3.0E-37
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 165 625 4.0E-37
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 169 621 6.0E-37
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 144 486 6.0E-37
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 123 486 9.0E-37
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 153 620 1.0E-36
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 147 628 1.0E-36
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 150 650 1.0E-36
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 147 637 2.0E-36
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 161 609 3.0E-36
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 151 603 4.0E-36
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 151 603 5.0E-36
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 147 620 6.0E-36
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 151 603 1.0E-35
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 161 603 2.0E-35
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 169 465 2.0E-35
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 147 637 2.0E-35
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 144 486 3.0E-35
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 166 467 3.0E-35
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 166 467 3.0E-35
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 166 618 6.0E-35
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 161 603 1.0E-34
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 169 615 2.0E-34
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 169 621 3.0E-34
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 126 603 3.0E-34
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 111 615 4.0E-34
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 165 628 1.0E-33
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 169 467 1.0E-33
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 161 609 3.0E-33
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 169 621 3.0E-33
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 123 479 4.0E-33
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 169 629 6.0E-33
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 166 618 8.0E-33
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 169 621 1.0E-32
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 228 465 2.0E-32
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 168 486 2.0E-32
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 149 627 2.0E-32
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 123 479 3.0E-32
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 165 628 4.0E-32
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 147 637 4.0E-32
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 168 486 9.0E-32
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 204 627 1.0E-31
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 166 603 1.0E-31
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 169 650 1.0E-31
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 132 603 2.0E-31
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 121 603 2.0E-31
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 168 486 2.0E-31
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 166 465 3.0E-31
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 204 624 4.0E-31
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 166 603 5.0E-31
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 144 486 6.0E-31
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 140 621 7.0E-31
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 169 650 8.0E-31
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 123 479 2.0E-30
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 144 486 4.0E-30
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 166 623 6.0E-30
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 144 486 7.0E-30
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 166 623 8.0E-30
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 166 603 2.0E-29
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 168 443 4.0E-29
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 169 542 5.0E-29
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 165 622 7.0E-29
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 171 465 1.0E-28
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 250 542 1.0E-28
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 165 622 2.0E-28
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 204 624 9.0E-28
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 169 465 3.0E-27
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 167 368 6.0E-27
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 166 617 2.0E-26
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 168 465 5.0E-26
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 166 368 7.0E-26
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 120 465 3.0E-25
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 116 465 4.0E-25
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 144 473 3.0E-24
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 168 471 3.0E-24
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 147 465 1.0E-23
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 229 466 3.0E-23
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 169 368 3.0E-23
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 188 507 3.0E-22
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 169 497 2.0E-21
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 250 465 5.0E-21
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 228 351 2.0E-20
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 228 351 7.0E-20
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 228 351 7.0E-20
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 228 351 2.0E-19
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 164 464 2.0E-19
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 231 417 1.0E-17
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 230 392 5.0E-16
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 166 325 1.0E-15
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 157 464 2.0E-13
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 168 465 1.0E-12
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 166 292 9.0E-11
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 166 292 9.0E-11
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 166 292 9.0E-11
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 207 345 3.0E-09
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 207 345 3.0E-09
sp|Q9ZQ91|CXE7_ARATH Probable carboxylesterase 7 OS=Arabidopsis thaliana GN=CXE7 PE=2 SV=1 229 373 2.0E-08
sp|Q9SMN0|CXE12_ARATH Probable carboxylesterase 12 OS=Arabidopsis thaliana GN=CXE12 PE=1 SV=1 228 363 2.0E-07
sp|Q6P093|ADCL2_HUMAN Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3 232 345 2.0E-06
sp|O64640|CXE8_ARATH Probable carboxylesterase 8 OS=Arabidopsis thaliana GN=CXE8 PE=2 SV=1 234 370 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079710
MRYSTIPYPDQSEGFDYLMRPVVRLTRTRANYVLTRQHFASYDRWSSEASSYLTSAATWMLKSEDLKPTNDDTSS
FSPGASRNIMIRHRSALKAGKHQEKVTVHFQKAEPSRLSTTKQRISMLLILAACAAFLQYHFTVSIKNDAAVVDL
GYAKYLGNQTTTWPNVVSYLGLPYAEPPVGNQRFRSPLPLNMTRVADEAMGQIIDARSYPEFCIQGKLGRGDHGG
AGSEDCLKVNVYNPVGVKSNAKLPVLVYIHGGGYVFGNPANWPFEHWIQQSPNVVIVSVYYRLDSLGFLATPEFA
DGSVGDLNAGFWDQIEALRWVQKHIGKFGGDPTKVTINGESAGGSSIELHLVARSGKEKLFRGAIAQSVFRAPLP
TPQQQEPLFSALATQVGCRSANVTDTMACLRSASISALAIAQDNVTEALSGYHAFRPVIDKKVFVDFPTRLIANG
AFKNVPLIVGATSNETLANGADIASAARSFFPSLTDDGVQAIEEAYPISSFASEELRQETATGDISVRCARSILA
SAWDAAHVDVWTYRYNQPDGTSHSPAAAHAAENYMMFRGTHTGVNGTTTFFALNPSEITFSEELIAYWLSFVREL
DPNSHKLARSPIWAQYTSEKRNRIVLNAASDRSNVIKTSGSHVELGDDELERCKVAASLVEQMQN*
Coding >AgabiH97|079710
ATGCGTTATTCGACCATCCCCTACCCCGATCAGTCCGAGGGCTTTGATTATCTGATGAGGCCGGTTGTTCGGTTA
ACGCGAACCCGTGCGAATTACGTACTCACGCGACAACACTTCGCGTCGTATGATCGTTGGAGCTCTGAAGCTTCG
AGTTACTTAACTTCCGCAGCAACCTGGATGTTGAAATCCGAAGACCTAAAGCCAACGAATGATGACACGTCCAGC
TTTTCTCCGGGAGCCTCAAGGAATATCATGATTCGCCATCGTTCGGCTCTGAAAGCGGGAAAACACCAGGAGAAA
GTTACTGTTCATTTTCAAAAAGCGGAGCCTTCGCGGCTTTCTACAACCAAACAGCGGATTTCAATGCTCCTCATA
CTAGCTGCTTGCGCTGCGTTCCTCCAGTACCACTTCACTGTATCTATAAAGAATGATGCCGCTGTTGTTGATCTG
GGCTATGCAAAATACTTGGGCAACCAAACGACAACTTGGCCCAATGTGGTATCGTATTTGGGTCTACCGTATGCT
GAACCGCCAGTTGGGAATCAACGTTTTCGCTCACCGCTCCCTCTGAATATGACGCGCGTGGCAGATGAGGCGATG
GGTCAAATAATAGATGCCAGATCATATCCGGAATTCTGCATTCAAGGTAAACTCGGCCGTGGTGATCATGGCGGA
GCTGGCAGCGAAGATTGTCTGAAGGTGAATGTGTACAACCCCGTTGGAGTTAAATCAAACGCAAAACTCCCTGTT
CTGGTTTATATCCACGGAGGTGGCTATGTGTTTGGAAATCCAGCGAACTGGCCATTTGAACACTGGATTCAACAA
AGCCCAAATGTCGTTATTGTCTCTGTTTACTATCGCCTCGATAGTTTGGGATTCCTAGCGACGCCAGAATTTGCT
GACGGCAGCGTTGGTGATCTTAATGCAGGTTTTTGGGATCAAATTGAAGCTTTGCGATGGGTTCAAAAGCATATC
GGTAAATTTGGTGGGGACCCAACCAAAGTGACAATCAATGGAGAGAGTGCTGGTGGATCGTCAATCGAATTGCAT
TTGGTCGCTAGGTCCGGGAAGGAAAAGTTATTCAGAGGTGCAATTGCGCAGAGTGTTTTCCGAGCACCTTTACCA
ACACCACAGCAGCAGGAGCCATTATTCAGCGCTCTGGCGACTCAGGTTGGTTGTCGTTCTGCCAACGTTACAGAC
ACAATGGCCTGTCTACGCTCAGCGAGTATCAGTGCGCTGGCTATCGCGCAGGACAACGTGACTGAGGCTCTCTCA
GGTTACCACGCATTTCGTCCAGTGATAGACAAAAAGGTTTTCGTTGACTTCCCCACTCGGCTGATTGCCAATGGA
GCTTTCAAGAACGTCCCACTCATTGTCGGGGCGACAAGCAATGAAACCCTTGCCAATGGCGCAGATATTGCTTCT
GCAGCCAGATCTTTCTTCCCTTCTCTTACCGATGACGGAGTGCAAGCTATAGAGGAGGCCTACCCCATCTCGTCG
TTTGCTTCAGAAGAACTCAGACAAGAAACAGCTACTGGTGATATTTCGGTTCGATGTGCTCGGTCCATTTTGGCC
TCAGCTTGGGACGCCGCCCACGTAGATGTGTGGACCTATCGGTATAATCAACCTGATGGTACCAGTCATAGCCCG
GCCGCAGCGCATGCAGCGGAGAATTATATGATGTTCCGTGGAACTCATACAGGCGTCAATGGAACAACAACGTTC
TTTGCATTAAATCCATCCGAAATAACATTTTCGGAAGAGCTCATCGCTTATTGGCTTTCCTTTGTTCGTGAACTT
GACCCCAACTCTCACAAACTCGCGCGTTCTCCGATCTGGGCACAATACACGAGCGAAAAGAGGAACAGGATTGTA
TTGAATGCAGCATCCGATCGGTCAAATGTGATTAAAACTAGTGGAAGCCACGTCGAACTTGGTGATGATGAGCTT
GAGAGATGTAAAGTTGCCGCTTCGTTGGTTGAGCAGATGCAGAATTGA
Transcript >AgabiH97|079710
ATGCGTTATTCGACCATCCCCTACCCCGATCAGTCCGAGGGCTTTGATTATCTGATGAGGCCGGTTGTTCGGTTA
ACGCGAACCCGTGCGAATTACGTACTCACGCGACAACACTTCGCGTCGTATGATCGTTGGAGCTCTGAAGCTTCG
AGTTACTTAACTTCCGCAGCAACCTGGATGTTGAAATCCGAAGACCTAAAGCCAACGAATGATGACACGTCCAGC
TTTTCTCCGGGAGCCTCAAGGAATATCATGATTCGCCATCGTTCGGCTCTGAAAGCGGGAAAACACCAGGAGAAA
GTTACTGTTCATTTTCAAAAAGCGGAGCCTTCGCGGCTTTCTACAACCAAACAGCGGATTTCAATGCTCCTCATA
CTAGCTGCTTGCGCTGCGTTCCTCCAGTACCACTTCACTGTATCTATAAAGAATGATGCCGCTGTTGTTGATCTG
GGCTATGCAAAATACTTGGGCAACCAAACGACAACTTGGCCCAATGTGGTATCGTATTTGGGTCTACCGTATGCT
GAACCGCCAGTTGGGAATCAACGTTTTCGCTCACCGCTCCCTCTGAATATGACGCGCGTGGCAGATGAGGCGATG
GGTCAAATAATAGATGCCAGATCATATCCGGAATTCTGCATTCAAGGTAAACTCGGCCGTGGTGATCATGGCGGA
GCTGGCAGCGAAGATTGTCTGAAGGTGAATGTGTACAACCCCGTTGGAGTTAAATCAAACGCAAAACTCCCTGTT
CTGGTTTATATCCACGGAGGTGGCTATGTGTTTGGAAATCCAGCGAACTGGCCATTTGAACACTGGATTCAACAA
AGCCCAAATGTCGTTATTGTCTCTGTTTACTATCGCCTCGATAGTTTGGGATTCCTAGCGACGCCAGAATTTGCT
GACGGCAGCGTTGGTGATCTTAATGCAGGTTTTTGGGATCAAATTGAAGCTTTGCGATGGGTTCAAAAGCATATC
GGTAAATTTGGTGGGGACCCAACCAAAGTGACAATCAATGGAGAGAGTGCTGGTGGATCGTCAATCGAATTGCAT
TTGGTCGCTAGGTCCGGGAAGGAAAAGTTATTCAGAGGTGCAATTGCGCAGAGTGTTTTCCGAGCACCTTTACCA
ACACCACAGCAGCAGGAGCCATTATTCAGCGCTCTGGCGACTCAGGTTGGTTGTCGTTCTGCCAACGTTACAGAC
ACAATGGCCTGTCTACGCTCAGCGAGTATCAGTGCGCTGGCTATCGCGCAGGACAACGTGACTGAGGCTCTCTCA
GGTTACCACGCATTTCGTCCAGTGATAGACAAAAAGGTTTTCGTTGACTTCCCCACTCGGCTGATTGCCAATGGA
GCTTTCAAGAACGTCCCACTCATTGTCGGGGCGACAAGCAATGAAACCCTTGCCAATGGCGCAGATATTGCTTCT
GCAGCCAGATCTTTCTTCCCTTCTCTTACCGATGACGGAGTGCAAGCTATAGAGGAGGCCTACCCCATCTCGTCG
TTTGCTTCAGAAGAACTCAGACAAGAAACAGCTACTGGTGATATTTCGGTTCGATGTGCTCGGTCCATTTTGGCC
TCAGCTTGGGACGCCGCCCACGTAGATGTGTGGACCTATCGGTATAATCAACCTGATGGTACCAGTCATAGCCCG
GCCGCAGCGCATGCAGCGGAGAATTATATGATGTTCCGTGGAACTCATACAGGCGTCAATGGAACAACAACGTTC
TTTGCATTAAATCCATCCGAAATAACATTTTCGGAAGAGCTCATCGCTTATTGGCTTTCCTTTGTTCGTGAACTT
GACCCCAACTCTCACAAACTCGCGCGTTCTCCGATCTGGGCACAATACACGAGCGAAAAGAGGAACAGGATTGTA
TTGAATGCAGCATCCGATCGGTCAAATGTGATTAAAACTAGTGGAAGCCACGTCGAACTTGGTGATGATGAGCTT
GAGAGATGTAAAGTTGCCGCTTCGTTGGTTGAGCAGATGCAGAATTGA
Gene >AgabiH97|079710
ATGCGTTATTCGACCATCCCCTACCCCGATCAGTCCGAGGGCTTTGATTATCTGATGAGTCAGATTCCGACTTAT
TCACACATGATACTGAAACTTTTTAACATATTTGACTCCAAGACGTGACGCTATGACCTGGTACTGTGGCCTGGA
TTTTCATCTGTTAACCCCACTGGATTTTCAAATCCTGCCAGTGGGGTAAACAGAGTGCTTGGCACTGCACCGTGA
CCTACCTGGCAAGGGCCGGTTGTTCGGTTAACGCGAACCCGTGCGAATTACGTACTCACGCGACAACACTTCGCG
TCGTATGATCGTTGGAGCTCTGAAGCTTCGAGTTACTTAGTAAGTGATCTTTTTCTCAATTAGAGGATTACGATT
CTCACCAGAAAAAGACTTCCGCAGCAACCTGGATGTTGAAAGTAGGACTCATGACTTGTAAGTGGAACTCTTTAC
TCAGGAAAAAGTCGCATGATTTGTGACCACATCGTCAGTTGCCATTGGTGGCTCAGAGATATCCCTGAGAATTTG
TTTCGCCCTTTCTAGTCCGAAGACCTAAAGCCAACGAATGATGACACGTCCAGCTTTTCTCCGGGAGCCTCAAGG
AATATCATGATTCGCCATCGTTCGGCTCTGAAAGCGGGAAAACACCAGGAGAAAGTTACTGTTCATTTTCAAAAA
GCGGAGCCTTCGCGGCTTTCTACAACCAAACAGCGGATTTCAATGCTCCTCATACTAGCTGCTTGCGCTGCGTTC
CTCCAGTACCACTTCACTGTATCTATAAAGAATGATGCCGCTGTTGTTGATCTGGGCTATGCAAAATACTTGGGC
AACCAAACGACAACTTGGCCCAATGTGGTATCGTATTTGGGTCTACCGTATGCTGAACCGCCAGTTGGGAATCAA
CGTTTTCGCTCACCGCTCCCTCTGAATATGACGCGCGTGGCAGATGAGGCGATGGGTCAAATAATAGATGCCAGA
TCATATCCGGAATTCTGCATTCAAGGTAAACTCGGCCGTGGTGAGCTCAAATTTTGGCCCTCTTAAAAATACAAA
TTAAGCTCGAACTTTCGACAGGTGATCATGGCGGAGCTGGCAGCGAAGATTGTCTGAAGGTGAATGTGTACAACC
CCGTTGGAGTTAAATCAAACGCAAAACGTAGGCCCATAAGATTCAGATATGTCCCCATGGATAGCTTCTGATATG
ACATCAGTCCCTGTTCTGGTTTATATCCACGGAGGTGGCTATGTGTTTGGAAATCCAGCGAACTGGCCATTTGAA
CACTGGATTCAACAAAGCCCAAATGTCGTTATTGTCTCTGTTTACTATCGCCTCGATAGTTTGGGATTCCTAGCG
ACGCCAGAATTTGCTGACGGCAGCGTTGGTGATCTTAATGCAGGTTTTTGGGATCAAATTGAAGCTTTGCGATGG
GTTCAAAAGCATATCGGTAAATTTGGTGGGGACCCAACCAAAGTGACAATCAATGGAGAGAGTGCTGGTGGATCG
TCAATCGAATTGCATTTGGTCGCTAGGTCCGGGAAGGAAAAGTTATTCAGAGGTGCAATTGCGCAGAGTGTTTTC
CGAGCACCTTTACCAACACCACAGCAGCAGGAGGTTAGTAACTTCAATTTAATTCAAAGTCGGTGATGATTGATA
TTGTCATACTTCCAGCCATTATTCAGCGCTCTGGCGACTCAGGTTGGTTGTCGTTCTGCCAACGTTACAGACACA
ATGGCCTGTCTACGCTCAGCGAGTATCAGTGCGCTGGCTATCGCGCAGGACAACGTGACTGAGGCTCTGTGGGTG
GTTACTCCCTAGCTCGTTCACATTTTTGTGACTTCATTTTAGCTCAGGTTACCACGCATTTCGTCCAGTGATAGA
CAAAAAGGTTTTCGTTGACTTCCCCACTCGGCTGATTGCCAATGGAGCTTTCAAGAACGTCCCACTCATTGTCGG
GTAAGACGGTCTAGGCAAGAGATTCAATGTATTGTTTAGTTGCATTTTGACAGGGCGACAAGCAATGAAACCCTT
GCCAATGGCGCAGATATTGCTTCTGCAGCCAGATCTTTCTTCCCTTCTCTTACCGATGACGGAGTGCAAGCTATA
GAGGAGGTATGATTCGAGGCTTCTCGCAATGAAAATTTCAAAGTGTTGCTCTCAGGCCTACCCCATCTCGTCGTT
TGCTTCAGAAGAACTCAGACAAGAAACAGCTACTGGTGATATTTCGGTTCGATGTGCTGTAAGTATTACTGTCGT
CTTAGAGTGCTGTTGGGACTTTGAAATATTGACCTAATTAGCGGTCCATTTTGGCCTCAGCTTGGGACGCCGCCC
ACGTAGATGTGTGGACCTATCGGTATAATCAACCTGATGGTACCAGTCATAGCCCGGCCGCAGCGCATGCAGCGG
AGAATTATATGATGTTCCGTGGAACTCATACAGGGTGCGTTTATAATCCCATTTTTACCCATTATTCTGACGTTT
GCAATATCCAGCGTCAATGGAACAACAACGTTCTTTGCATTAAATCCATCCGAAATAACATTTTCGGAAGAGCTC
ATCGCTTATTGGCTTTCCTTTGTTCGTGAACTTGACCCCAACTCTCACAAACTCGCGCGTTCTCCGATCTGGGCA
CAATACACGAGCGAAAAGAGGAACAGGATTGTATTGAATGCAGCATCCGATCGGTCAAATGTGATTAAAACTAGT
GGAAGCCACGTCGAACTTGGTGATGATGAGCTTGAGAGATGTAAAGTTGCCGCTTCGTTGGTTGAGCAGATGCAG
AATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail