Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079690
Gene name
Locationscaffold_5:397642..399355
Strand+
Gene length (bp)1713
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.2E-26 107 355
PF00975 Thioesterase Thioesterase domain 2.8E-09 104 229
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-07 102 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO63|PPME1_CRYNB Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PPE1 PE=3 SV=1 1 369 4.0E-107
sp|P0CO62|PPME1_CRYNJ Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPE1 PE=3 SV=1 1 369 4.0E-107
sp|Q2URJ0|PPME1_ASPOR Protein phosphatase methylesterase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppe1 PE=3 SV=2 1 366 3.0E-83
sp|Q5BGN7|PPME1_EMENI Protein phosphatase methylesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppe1 PE=3 SV=2 1 366 1.0E-79
sp|Q4WKB2|PPME1_ASPFU Protein phosphatase methylesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppe1 PE=3 SV=1 93 366 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CO63|PPME1_CRYNB Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PPE1 PE=3 SV=1 1 369 4.0E-107
sp|P0CO62|PPME1_CRYNJ Protein phosphatase methylesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPE1 PE=3 SV=1 1 369 4.0E-107
sp|Q2URJ0|PPME1_ASPOR Protein phosphatase methylesterase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppe1 PE=3 SV=2 1 366 3.0E-83
sp|Q5BGN7|PPME1_EMENI Protein phosphatase methylesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppe1 PE=3 SV=2 1 366 1.0E-79
sp|Q4WKB2|PPME1_ASPFU Protein phosphatase methylesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppe1 PE=3 SV=1 93 366 2.0E-78
sp|Q6CGE1|PPME1_YARLI Protein phosphatase methylesterase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPE1 PE=3 SV=1 61 367 5.0E-77
sp|Q4IQC1|PPME1_GIBZE Protein phosphatase methylesterase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPE1 PE=3 SV=1 105 369 1.0E-76
sp|P38796|PPME1_YEAST Protein phosphatase methylesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPE1 PE=1 SV=1 28 372 1.0E-71
sp|Q7SGG8|PPME1_NEUCR Protein phosphatase methylesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pme-1 PE=3 SV=1 88 366 6.0E-71
sp|Q9P7D2|PPME1_SCHPO Protein phosphatase methylesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=3 SV=1 74 369 7.0E-71
sp|Q6FNL6|PPME1_CANGA Protein phosphatase methylesterase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPE1 PE=3 SV=1 3 372 3.0E-70
sp|Q9BIB3|PPME1_CAEEL Probable protein phosphatase methylesterase 1 OS=Caenorhabditis elegans GN=B0464.9 PE=3 SV=1 47 364 1.0E-68
sp|Q74Z47|PPME1_ASHGO Protein phosphatase methylesterase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPE1 PE=3 SV=1 25 372 4.0E-61
sp|Q58DN4|PPME1_BOVIN Protein phosphatase methylesterase 1 OS=Bos taurus GN=PPME1 PE=2 SV=3 40 364 9.0E-61
sp|Q9Y570|PPME1_HUMAN Protein phosphatase methylesterase 1 OS=Homo sapiens GN=PPME1 PE=1 SV=3 40 364 1.0E-60
sp|Q4FZT2|PPME1_RAT Protein phosphatase methylesterase 1 OS=Rattus norvegicus GN=Ppme1 PE=1 SV=2 40 364 1.0E-60
sp|Q8BVQ5|PPME1_MOUSE Protein phosphatase methylesterase 1 OS=Mus musculus GN=Ppme1 PE=1 SV=5 40 364 2.0E-60
sp|Q5R4F9|PPME1_PONAB Protein phosphatase methylesterase 1 OS=Pongo abelii GN=PPME1 PE=2 SV=3 40 364 1.0E-59
sp|Q6CQZ5|PPME1_KLULA Protein phosphatase methylesterase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPE1 PE=3 SV=1 75 372 1.0E-59
sp|Q6BZG3|PPME1_DEBHA Protein phosphatase methylesterase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPE1 PE=3 SV=2 85 373 7.0E-55
sp|Q5ALW7|PPME1_CANAL Protein phosphatase methylesterase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPE1 PE=3 SV=1 40 363 2.0E-53
sp|Q54TN3|PPME1_DICDI Probable protein phosphatase methylesterase 1 OS=Dictyostelium discoideum GN=ppme1 PE=3 SV=1 44 350 4.0E-52
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 49.53 28.82 70.25
Initials Initials knots 38.98 22.26 55.71
Pileal_Stipeal_center Stage I stipe center 12.42 6.15 18.69
Pileal_Stipeal_shell Stage I stipe shell 21.61 11.48 31.74
DIF_stipe_center Stage II stipe center 14.19 7.10 21.28
DIF_stipe_shell Stage II stipe shell 6.58 2.97 10.19
DIF_stipe_skin Stage II stipe skin 10.92 5.28 16.57
DIF_cap_skin Stage II cap skin 12.22 6.02 18.41
DIF_cap_tissue Stage II cap tissue 12.97 6.25 19.69
DIF_gill_tissue Stage II gill tissue 20.67 10.94 30.40
YFB_stipe_center Young fruiting body stipe center 16.61 8.39 24.84
YFB_stipe_shell Young fruiting body stipe shell 11.37 5.56 17.18
YFB_stipe_skin Young fruiting body stipe skin 12.79 6.18 19.40
YFB_cap_skin Young fruiting body cap skin 12.30 6.08 18.52
YFB_cap_tissue Young fruiting body cap tissue 6.64 3.00 10.29
YFB_gill_tissue Young fruiting body gill tissue 18.99 9.95 28.03
YFB_veil Young fruiting body veil 19.21 10.04 28.37

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.002084 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.509348 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.002951 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.626419 no
DIF_gill_tissue YFB_stipe_shell 0.066395 no
DIF_gill_tissue YFB_stipe_skin 0.180832 no
DIF_gill_tissue YFB_cap_skin 0.135445 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.880038 no
DIF_gill_tissue YFB_veil 0.899402 no
YFB_stipe_center YFB_stipe_shell 0.317155 no
YFB_stipe_center YFB_stipe_skin 0.564308 no
YFB_stipe_center YFB_cap_skin 0.467620 no
YFB_stipe_center YFB_cap_tissue 0.004928 yes
YFB_stipe_center YFB_gill_tissue 0.800803 no
YFB_stipe_center YFB_veil 0.777250 no
YFB_stipe_shell YFB_stipe_skin 0.841482 no
YFB_stipe_shell YFB_cap_skin 0.900630 no
YFB_stipe_shell YFB_cap_tissue 0.147547 no
YFB_stipe_shell YFB_gill_tissue 0.128955 no
YFB_stipe_shell YFB_veil 0.120972 no
YFB_stipe_skin YFB_cap_skin 0.955865 no
YFB_stipe_skin YFB_cap_tissue 0.070499 no
YFB_stipe_skin YFB_gill_tissue 0.298146 no
YFB_stipe_skin YFB_veil 0.285338 no
YFB_cap_skin YFB_cap_tissue 0.088950 no
YFB_cap_skin YFB_gill_tissue 0.227928 no
YFB_cap_skin YFB_veil 0.219193 no
YFB_cap_tissue YFB_gill_tissue 0.001140 yes
YFB_cap_tissue YFB_veil 0.001140 yes
YFB_gill_tissue YFB_veil 0.985153 no
Initials DIF_gill_tissue 0.030610 yes
Initials YFB_stipe_center 0.003365 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.001140 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.011041 yes
Initials YFB_veil 0.013485 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.046327 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.143342 no
Pileal_Stipeal_center YFB_stipe_center 0.492381 no
Pileal_Stipeal_center YFB_stipe_shell 0.886878 no
Pileal_Stipeal_center YFB_stipe_skin 0.965656 no
Pileal_Stipeal_center YFB_cap_skin 0.988621 no
Pileal_Stipeal_center YFB_cap_tissue 0.081583 no
Pileal_Stipeal_center YFB_gill_tissue 0.238213 no
Pileal_Stipeal_center YFB_veil 0.229147 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.099106 no
Pileal_Stipeal_center DIF_stipe_center 0.814412 no
Pileal_Stipeal_center DIF_stipe_shell 0.079655 no
Pileal_Stipeal_center DIF_stipe_skin 0.828116 no
Pileal_Stipeal_center DIF_cap_skin 0.980836 no
Pileal_Stipeal_center DIF_cap_tissue 0.951222 no
Pileal_Stipeal_shell DIF_gill_tissue 0.944917 no
Pileal_Stipeal_shell YFB_stipe_center 0.538285 no
Pileal_Stipeal_shell YFB_stipe_shell 0.044844 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.133289 no
Pileal_Stipeal_shell YFB_cap_skin 0.097608 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.807659 no
Pileal_Stipeal_shell YFB_veil 0.827829 no
Pileal_Stipeal_shell DIF_stipe_center 0.257674 no
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.039836 yes
Pileal_Stipeal_shell DIF_cap_skin 0.088950 no
Pileal_Stipeal_shell DIF_cap_tissue 0.157303 no
DIF_stipe_center DIF_gill_tissue 0.333265 no
DIF_stipe_center YFB_stipe_center 0.762146 no
DIF_stipe_center YFB_stipe_shell 0.648885 no
DIF_stipe_center YFB_stipe_skin 0.864100 no
DIF_stipe_center YFB_cap_skin 0.795220 no
DIF_stipe_center YFB_cap_tissue 0.029890 yes
DIF_stipe_center YFB_gill_tissue 0.488497 no
DIF_stipe_center YFB_veil 0.466797 no
DIF_stipe_center DIF_stipe_shell 0.025963 yes
DIF_stipe_center DIF_stipe_skin 0.581233 no
DIF_stipe_center DIF_cap_skin 0.786047 no
DIF_stipe_center DIF_cap_tissue 0.887548 no
DIF_stipe_shell DIF_gill_tissue 0.001140 yes
DIF_stipe_shell YFB_stipe_center 0.003765 yes
DIF_stipe_shell YFB_stipe_shell 0.134864 no
DIF_stipe_shell YFB_stipe_skin 0.065465 no
DIF_stipe_shell YFB_cap_skin 0.082106 no
DIF_stipe_shell YFB_cap_tissue 0.988848 no
DIF_stipe_shell YFB_gill_tissue 0.001625 yes
DIF_stipe_shell YFB_veil 0.001625 yes
DIF_stipe_shell DIF_stipe_skin 0.194610 no
DIF_stipe_shell DIF_cap_skin 0.085898 no
DIF_stipe_shell DIF_cap_tissue 0.060299 no
DIF_stipe_skin DIF_gill_tissue 0.058542 no
DIF_stipe_skin YFB_stipe_center 0.270057 no
DIF_stipe_skin YFB_stipe_shell 0.953972 no
DIF_stipe_skin YFB_stipe_skin 0.783711 no
DIF_stipe_skin YFB_cap_skin 0.844050 no
DIF_stipe_skin YFB_cap_tissue 0.207399 no
DIF_stipe_skin YFB_gill_tissue 0.111334 no
DIF_stipe_skin YFB_veil 0.103317 no
DIF_stipe_skin DIF_cap_skin 0.855487 no
DIF_stipe_skin DIF_cap_tissue 0.762847 no
DIF_cap_skin DIF_gill_tissue 0.125287 no
DIF_cap_skin YFB_stipe_center 0.460105 no
DIF_cap_skin YFB_stipe_shell 0.909784 no
DIF_cap_skin YFB_stipe_skin 0.947340 no
DIF_cap_skin YFB_cap_skin 0.992149 no
DIF_cap_skin YFB_cap_tissue 0.088950 no
DIF_cap_skin YFB_gill_tissue 0.222923 no
DIF_cap_skin YFB_veil 0.212366 no
DIF_cap_skin DIF_cap_tissue 0.929808 no
DIF_cap_tissue DIF_gill_tissue 0.205647 no
DIF_cap_tissue YFB_stipe_center 0.598128 no
DIF_cap_tissue YFB_stipe_shell 0.822653 no
DIF_cap_tissue YFB_stipe_skin 0.983860 no
DIF_cap_tissue YFB_cap_skin 0.937631 no
DIF_cap_tissue YFB_cap_tissue 0.063376 no
DIF_cap_tissue YFB_gill_tissue 0.328105 no
DIF_cap_tissue YFB_veil 0.316139 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079690
MSDLFRSAISARLAKLPPDIQGHAGEDEEDEESADSIGALPGSGMGPPAMPSSSARKRKKKDPNAEFAPLSASGF
FNEAVQVKVPSRSLDVRVYYTPPKFTDATVMVCHHGAGYSGSSFACFAKEVTDQTNGECGVLALDARRHGKTTST
ADDSDLSINVLVEDFFELVQAIFPDPVTAPTLLLIGHSMGGSVTVQSCPRLLERGYKITGVAVLDVVEGSAIEAL
PHMHSLLNARPEGFDSMEEAIEWHVTTNTIRNPTSARISIPSIIEHNDSAVYPYQWRTPLRSTAPYWQNWFTGLS
EKFLAARAARLLVLAGTDRLDKELMIGQMQGKFQLVVVPGTGHMIQEDDPKKLAEILVEFWLRNERVVVGIKKVG
EK*
Coding >AgabiH97|079690
ATGTCAGATCTCTTCCGGTCAGCCATAAGCGCACGGCTTGCAAAGCTTCCACCAGATATTCAAGGTCACGCTGGT
GAGGATGAGGAAGACGAAGAGTCAGCTGATTCCATTGGTGCACTCCCGGGTAGTGGCATGGGTCCTCCGGCAATG
CCGTCAAGTAGCGCGAGAAAACGAAAGAAGAAAGATCCCAATGCTGAATTCGCACCCTTATCTGCATCTGGTTTT
TTCAATGAAGCCGTTCAAGTTAAGGTGCCATCCAGGAGTCTTGATGTTAGGGTATACTACACGCCACCCAAATTC
ACGGATGCGACCGTTATGGTCTGTCATCACGGTGCTGGCTACTCTGGATCCAGCTTCGCCTGTTTTGCGAAAGAG
GTGACTGATCAGACGAATGGAGAATGTGGGGTTTTAGCCTTAGATGCTCGACGTCACGGAAAAACAACTTCTACA
GCCGATGATAGCGATCTTTCTATCAATGTCCTTGTTGAGGACTTCTTCGAGCTCGTTCAAGCCATCTTTCCGGAC
CCTGTTACAGCCCCAACACTATTGCTCATTGGGCATAGCATGGGCGGCTCTGTCACAGTTCAATCTTGCCCAAGA
CTTTTAGAACGTGGGTACAAAATCACAGGAGTAGCAGTTCTTGATGTCGTCGAAGGCTCTGCTATCGAAGCTCTA
CCTCATATGCACAGCCTCCTGAATGCCCGACCGGAAGGTTTCGATAGCATGGAAGAGGCCATAGAGTGGCATGTG
ACCACCAACACGATCCGGAATCCGACTTCCGCTAGAATCTCCATCCCATCCATTATAGAACACAACGACTCCGCC
GTATATCCATATCAATGGCGGACTCCACTTCGCTCGACAGCACCTTACTGGCAAAATTGGTTTACAGGGCTTTCC
GAAAAGTTTCTTGCTGCACGCGCAGCTCGTCTACTAGTACTTGCGGGTACAGATAGGCTTGACAAAGAACTAATG
ATAGGCCAAATGCAAGGCAAGTTCCAGCTTGTCGTGGTCCCTGGAACAGGGCATATGATACAAGAAGACGATCCG
AAGAAATTAGCTGAAATTTTAGTCGAGTTCTGGCTTCGTAATGAACGCGTAGTGGTCGGAATTAAGAAGGTCGGA
GAGAAATGA
Transcript >AgabiH97|079690
ATGTCAGATCTCTTCCGGTCAGCCATAAGCGCACGGCTTGCAAAGCTTCCACCAGATATTCAAGGTCACGCTGGT
GAGGATGAGGAAGACGAAGAGTCAGCTGATTCCATTGGTGCACTCCCGGGTAGTGGCATGGGTCCTCCGGCAATG
CCGTCAAGTAGCGCGAGAAAACGAAAGAAGAAAGATCCCAATGCTGAATTCGCACCCTTATCTGCATCTGGTTTT
TTCAATGAAGCCGTTCAAGTTAAGGTGCCATCCAGGAGTCTTGATGTTAGGGTATACTACACGCCACCCAAATTC
ACGGATGCGACCGTTATGGTCTGTCATCACGGTGCTGGCTACTCTGGATCCAGCTTCGCCTGTTTTGCGAAAGAG
GTGACTGATCAGACGAATGGAGAATGTGGGGTTTTAGCCTTAGATGCTCGACGTCACGGAAAAACAACTTCTACA
GCCGATGATAGCGATCTTTCTATCAATGTCCTTGTTGAGGACTTCTTCGAGCTCGTTCAAGCCATCTTTCCGGAC
CCTGTTACAGCCCCAACACTATTGCTCATTGGGCATAGCATGGGCGGCTCTGTCACAGTTCAATCTTGCCCAAGA
CTTTTAGAACGTGGGTACAAAATCACAGGAGTAGCAGTTCTTGATGTCGTCGAAGGCTCTGCTATCGAAGCTCTA
CCTCATATGCACAGCCTCCTGAATGCCCGACCGGAAGGTTTCGATAGCATGGAAGAGGCCATAGAGTGGCATGTG
ACCACCAACACGATCCGGAATCCGACTTCCGCTAGAATCTCCATCCCATCCATTATAGAACACAACGACTCCGCC
GTATATCCATATCAATGGCGGACTCCACTTCGCTCGACAGCACCTTACTGGCAAAATTGGTTTACAGGGCTTTCC
GAAAAGTTTCTTGCTGCACGCGCAGCTCGTCTACTAGTACTTGCGGGTACAGATAGGCTTGACAAAGAACTAATG
ATAGGCCAAATGCAAGGCAAGTTCCAGCTTGTCGTGGTCCCTGGAACAGGGCATATGATACAAGAAGACGATCCG
AAGAAATTAGCTGAAATTTTAGTCGAGTTCTGGCTTCGTAATGAACGCGTAGTGGTCGGAATTAAGAAGGTCGGA
GAGAAATGA
Gene >AgabiH97|079690
ATGTCAGATCTCTTCCGGTCAGCCATAAGCGCACGGCTTGCAAAGCTTCCACCAGATATTCAAGGTCACGCTGGT
GAGGATGAGGAAGACGAAGAGTCAGCTGATTCCATTGGTGCACTCCCGGGTAGTGGCATGGGTCCTCCGGCAATG
CAAGTCGAGTTCATTTGAATCGCCTAGGGACTATCATCTAAGACAGAGAATCAAGGCCGTCAAGTAGCGCGAGAA
AACGAAAGAAGAAAGATCCCAATGCTGAATTCGCACCCTTATCTGCATCTGGTTTTTTCAATGAAGCCGTTCAAG
TTAAGGTGCCATCCAGGAGTCTTGATGTTAGGGTATACTACACGCCACCCAAATTCACGGATGCGACCGTTATGG
TCTGTCATCACGGTGCTGGCTACTCTGGATCCAGCTTCGCCTGTTTTGCGAAAGAGGTGACTGATCAGACGAATG
GAGAATGTGGGGTTTTAGCCTTAGATGCTCGACGTCACGGTTAGTATCAAATTGTCAAGTTTGACTACACTAATC
ATCGGCGGATATGATGTTCAGGAAAAACAACTTCTACAGCCGATGATAGCGATCTTTCTATCAATGTCCTTGTTG
AGGACTTCTTCGAGCTCGTTCAAGCCATCTTTCCGGACCCTGTTACAGCCCCAACACTATTGGTTAGTAGCCTAT
ATTCTCGCGGTCATATAGATTGCTTATGCAGTGCACCACAGCTCATTGGGCATAGCATGGGCGGCTCTGTCACAG
TTCAATCTTGCCCAAGACTTTTAGAACGTGGGTACAAAATCACAGGAGTAGCAGTTCTTGATGTCGTCGAAGGTG
CATTTTAAATCCTTACCACACTCGTAACCTAATTTAACCATATCTTCATCTTTAGGCTCTGCTATCGAAGCTCTA
CCTCATATGCACAGCCTCCTGAATGCCCGACCGGAAGGTTTCGATAGCATGGAAGAGGCCATAGAGTGGCAGTAT
GTGACTTTCTTCTCCGTTAGCTCCTTGCTTGATCCAGTTATGATTTCATTTTCCGATGAACCTTCTATACCTGTT
TCATCAACGTGTTTGTTCATTTGTTGCTGTTGTTATTTCATTCTGCCACTTCACCCTTATACTCCTCCCGAACGC
CATTAACTCGGTCTTATTCGGATAGTGTGACCACCAACACGATCCGGAATCCGACTTCCGCTAGAATCTCCATCC
CATCCATTATAGAACACAACGACTCCGCCGTATATCCATATCAATGGCGGACTCCACTTCGCTCGACAGCACCTT
ACTGGCAAAGTGAGTCTTCCATCGATTTCCCACCCGTAGAGGCGCTCTCATTTGAGTACGAATTAACAAATGAGT
ATTAGATTGGTTTACAGGGCTTTCCGAAAAGTTTCTTGCTGCACGCGCAGCTCGTCTACTAGTACTTGCGGGTAC
AGATAGGCTTGACAAAGAACTAATGATAGGCCAAATGCAAGGCAAGTTCCAGCTTGTCGTGGTCCCTGGAACAGG
GCATATGATACAAGAAGTACGTATCTCTCGTCATCTTTCCCCGAGCACATGGACGTGGCACTCTCAATTGTTCCG
AATTCGTATCTATGGTTGTGACATGCTGATGCAAAATACTATTAGGACGATCCGAAGAAATTAGCTGAAATTTTA
GTCGAGTTCTGGCTTCGTAATGAACGCGTAGTGGTCGGAATTAAGAAGGTCGGAGAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail