Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079680
Gene name
Locationscaffold_5:396249..397572
Strand-
Gene length (bp)1323
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05705 DUF829 Eukaryotic protein of unknown function (DUF829) 1.7E-35 61 308

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DHN0|TMM53_DANRE Transmembrane protein 53 OS=Danio rerio GN=tmem53 PE=2 SV=1 56 300 1.0E-15
sp|Q6DJC8|TM53B_XENLA Transmembrane protein 53-B OS=Xenopus laevis GN=tmem53-b PE=2 SV=1 62 300 1.0E-11
sp|Q6P2H8|TMM53_HUMAN Transmembrane protein 53 OS=Homo sapiens GN=TMEM53 PE=2 SV=1 49 300 2.0E-08
sp|Q2TBP5|TMM53_BOVIN Transmembrane protein 53 OS=Bos taurus GN=TMEM53 PE=2 SV=1 49 300 3.0E-07
sp|Q9D0Z3|TMM53_MOUSE Transmembrane protein 53 OS=Mus musculus GN=Tmem53 PE=2 SV=1 62 300 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079680
MLFGANKLRIKAVSGLAPDPQKSMAGEMVSMTANDTCVKVGEGIHLYRPTEPGPIKSSHPTVVLIFGWMAARFSH
LQKYTSIYRERQRAQHKALAPLVDVLEALGLIHPLQEASKPRKTPLDSIVPLPTHRILLHVFSNGGCCQLMILGS
IISNRRAASLTTATHTPASALILDSCPGDGGFSSAERAFTISVTNPLLRMLVKLGVIILFSLRLVMEHVFRQQSA
IPFMRSQLNDPDMVPWLNKNSPRLYIYSEGDEMVPVHAVEQHMKDAVEKGFNVQPVKFGKESKHVAHARSDPSRY
WGATEQMWKEAIGVQD*
Coding >AgabiH97|079680
ATGCTCTTTGGTGCAAACAAACTTCGCATCAAGGCTGTGAGCGGCTTGGCCCCGGATCCCCAAAAGAGCATGGCA
GGGGAGATGGTTTCTATGACGGCTAACGATACTTGTGTCAAGGTCGGTGAAGGAATACACCTCTACCGACCCACA
GAACCTGGTCCCATAAAATCATCGCACCCAACGGTCGTTCTCATTTTTGGTTGGATGGCAGCTAGATTCTCCCAT
CTTCAGAAATATACCTCTATCTATCGTGAACGTCAACGTGCACAACACAAAGCTCTCGCTCCTTTAGTAGACGTC
CTTGAAGCTCTTGGATTGATTCATCCTTTACAAGAAGCTTCGAAACCCCGCAAAACGCCATTGGACTCGATTGTT
CCCCTCCCAACACATAGAATTCTGCTTCACGTATTCAGCAACGGCGGTTGTTGCCAGCTCATGATCCTCGGCAGC
ATTATTTCTAACCGTCGCGCAGCATCCCTAACCACAGCCACACACACGCCTGCCAGTGCCCTGATCCTCGACTCC
TGTCCAGGTGACGGCGGTTTCTCTTCAGCTGAACGTGCATTTACTATCTCTGTCACCAATCCTCTTCTTCGAATG
CTAGTCAAACTTGGTGTCATCATCCTCTTCAGCCTCCGGCTCGTCATGGAACACGTTTTTCGCCAACAATCCGCT
ATACCTTTTATGAGGTCCCAACTTAACGATCCTGATATGGTACCATGGCTAAACAAAAACTCACCGAGGTTGTAC
ATATACTCCGAAGGAGACGAAATGGTTCCTGTCCATGCTGTAGAGCAGCATATGAAGGACGCGGTGGAGAAAGGA
TTTAATGTACAGCCTGTGAAATTCGGAAAGGAGTCAAAGCATGTTGCTCATGCAAGGAGTGACCCGTCTAGATAT
TGGGGAGCTACAGAGCAGATGTGGAAAGAAGCGATCGGGGTGCAGGACTAA
Transcript >AgabiH97|079680
ATGCTCTTTGGTGCAAACAAACTTCGCATCAAGGCTGTGAGCGGCTTGGCCCCGGATCCCCAAAAGAGCATGGCA
GGGGAGATGGTTTCTATGACGGCTAACGATACTTGTGTCAAGGTCGGTGAAGGAATACACCTCTACCGACCCACA
GAACCTGGTCCCATAAAATCATCGCACCCAACGGTCGTTCTCATTTTTGGTTGGATGGCAGCTAGATTCTCCCAT
CTTCAGAAATATACCTCTATCTATCGTGAACGTCAACGTGCACAACACAAAGCTCTCGCTCCTTTAGTAGACGTC
CTTGAAGCTCTTGGATTGATTCATCCTTTACAAGAAGCTTCGAAACCCCGCAAAACGCCATTGGACTCGATTGTT
CCCCTCCCAACACATAGAATTCTGCTTCACGTATTCAGCAACGGCGGTTGTTGCCAGCTCATGATCCTCGGCAGC
ATTATTTCTAACCGTCGCGCAGCATCCCTAACCACAGCCACACACACGCCTGCCAGTGCCCTGATCCTCGACTCC
TGTCCAGGTGACGGCGGTTTCTCTTCAGCTGAACGTGCATTTACTATCTCTGTCACCAATCCTCTTCTTCGAATG
CTAGTCAAACTTGGTGTCATCATCCTCTTCAGCCTCCGGCTCGTCATGGAACACGTTTTTCGCCAACAATCCGCT
ATACCTTTTATGAGGTCCCAACTTAACGATCCTGATATGGTACCATGGCTAAACAAAAACTCACCGAGGTTGTAC
ATATACTCCGAAGGAGACGAAATGGTTCCTGTCCATGCTGTAGAGCAGCATATGAAGGACGCGGTGGAGAAAGGA
TTTAATGTACAGCCTGTGAAATTCGGAAAGGAGTCAAAGCATGTTGCTCATGCAAGGAGTGACCCGTCTAGATAT
TGGGGAGCTACAGAGCAGATGTGGAAAGAAGCGATCGGGGTGCAGGACTAA
Gene >AgabiH97|079680
ATGCTCTTTGGTGCAAACAAACTTCGCATCAAGGCTGTGAGCGGCTTGGCCCCGGATCCCCAAAAGAGCATGGCA
GGGGTTTCATTTGCGTTGAATCACACAGTCCCCCACATAGAACGAGTGCTAGGAGGTGAGTATTCAGTGTACTGT
TTTTCTAATCAAGTTAACTTAGCCTTTCTAGATGGTTTCTATGACGGCTAACGATACTTGTGTCAAGGTCGGTGA
AGGAATACACCTCTACCGACCCACAGAACCTGGTCCCATAAAATCATCGCACCCAACGTGAGTGAACCCGCATAA
GTTTCGTCTATATCGCCAACTCATCATTATATTGTAGGGTCGTTCTCATTTTTGGTTGGAGTATGTATACCCCAG
AATTGCAATGACGACACCACGCTAAACTGAACTATACTCCTAGTGGCAGCTAGATTCTCCCATCTTCAGAAATAT
ACCTCTATCTATCGTGAACGGTACCCAAATACGACGTTGGTCTTGACTCAATGCGAACCTTCTTTTTTTTGGAGC
AGTCAACGTGCACAAGTACGTCAACGGTCATACCACTGGCTTAAATCGCTAATTTATTTTGTAAAAGCACAAAGC
TCTCGCTCCTTTAGTAGACGTCCTTGAAGCTCTTGGATTGATTCATCCTTTACAAGAAGCTTCGAAACCCCGCAA
AACGCCATTGGACTCGATTGTTCCCCTCCCAACACATAGAATTCTGCTTCACGTATTCAGCAACGGTATATTCAT
TGCGACCTTCTTAGTCCTCATGACTCATTCCAACTTCCAGGCGGTTGTTGCCAGCTCATGATCCTCGGCAGCATT
ATTTCTAACCGTCGCGCAGCATCCCTAACCACAGCCACACACACGCCTGCCAGTGCCCTGATCCTCGACTCCTGT
CCAGGTGACGGCGGTTTCTCTTCAGCTGAACGTGCATTTACTATCTCTGTCACCAATCCTCTTCTTCGAATGCTA
GTCAAACTTGGTGTCATCATCCTCTTCAGCCTCCGGCTCGTCATGGAACACGTTTTTCGCCAACAATCCGCTATA
CCTTTTATGAGGTCCCAACTTAACGATCCTGATATGGTACCATGGCTAAACAAAAACTCACCGAGGTTGTACATA
TACTCCGAAGGAGACGAAATGGTTCCTGTCCATGCTGTAGAGCAGCATATGAAGGACGCGGTGGAGAAAGGATTT
AATGTACAGCCTGTGAAATTCGGAAAGGAGTCAAAGCATGTTGCTCATGCAAGGAGTGACCCGTCTAGATATTGG
GGAGCTACAGAGCAGATGTGGAAAGAAGCGATCGGGGTGCAGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail