Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079510
Gene name
Locationscaffold_5:345058..349978
Strand-
Gene length (bp)4920
Transcript length (bp)4866
Coding sequence length (bp)4866
Protein length (aa) 1622

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 2.8E-69 1142 1378
PF00665 rve Integrase core domain 1.7E-13 645 743
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 8.6E-11 72 199
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.2E-08 583 632

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 441 1616 4.0E-127
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1103 1616 3.0E-118
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 439 846 4.0E-52
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1216 1525 2.0E-41
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1152 1610 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 441 1616 4.0E-127
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1103 1616 3.0E-118
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 439 846 4.0E-52
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1216 1525 2.0E-41
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1152 1610 4.0E-29
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1152 1610 8.0E-29
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 1152 1610 9.0E-29
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1152 1610 9.0E-29
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1152 1610 1.0E-28
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1152 1610 1.0E-28
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1152 1610 1.0E-28
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1152 1610 1.0E-28
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1152 1610 1.0E-28
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1152 1610 1.0E-28
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1152 1610 2.0E-28
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1152 1610 2.0E-28
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1152 1610 2.0E-28
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1152 1610 2.0E-28
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1152 1610 3.0E-28
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1152 1610 3.0E-28
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1152 1610 3.0E-28
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1152 1610 3.0E-28
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1152 1610 3.0E-28
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1152 1610 3.0E-28
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1152 1610 4.0E-28
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1152 1610 4.0E-28
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1152 1610 4.0E-28
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1152 1610 4.0E-28
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1152 1610 4.0E-28
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1152 1610 5.0E-28
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1152 1610 5.0E-28
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 1152 1610 6.0E-28
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1152 1610 7.0E-28
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1152 1610 7.0E-28
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1152 1610 9.0E-28
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 1152 1610 1.0E-27
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1152 1610 1.0E-27
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1152 1610 1.0E-27
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1152 1610 2.0E-27
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 1152 1610 3.0E-27
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1152 1610 3.0E-27
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 1152 1610 4.0E-27
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1152 1610 5.0E-27
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1152 1610 7.0E-27
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1152 1610 1.0E-26
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1152 1610 1.0E-26
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1152 1610 1.0E-26
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1302 1527 9.0E-26
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1132 1621 8.0E-24
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1132 1621 1.0E-23
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1152 1458 3.0E-18
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1152 1375 1.0E-15
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 430 837 3.0E-13
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 430 788 5.0E-13
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 438 788 5.0E-13
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 430 788 6.0E-13
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 430 788 6.0E-13
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 438 788 6.0E-13
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 438 788 6.0E-13
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 430 788 6.0E-13
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 430 788 7.0E-13
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 438 788 7.0E-13
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 438 788 7.0E-13
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 438 788 9.0E-13
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 434 837 4.0E-12
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 434 837 5.0E-12
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 434 837 5.0E-12
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 434 837 9.0E-12
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 434 837 1.0E-11
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 434 837 1.0E-11
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 434 837 1.0E-11
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 434 837 1.0E-11
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 434 837 1.0E-11
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 434 837 1.0E-11
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 754 839 1.0E-11
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 434 837 2.0E-11
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 434 837 2.0E-11
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 434 837 2.0E-11
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 434 837 2.0E-11
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 434 837 2.0E-11
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 434 837 2.0E-11
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 434 837 2.0E-11
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 434 837 2.0E-11
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 434 837 2.0E-11
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 434 837 3.0E-11
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 434 837 3.0E-11
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 434 837 4.0E-11
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 434 837 5.0E-11
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 434 837 5.0E-11
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 434 837 6.0E-11
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 434 837 6.0E-11
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 434 837 6.0E-11
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 434 837 6.0E-11
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 434 837 7.0E-11
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 434 837 7.0E-11
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 434 837 8.0E-11
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 434 837 1.0E-10
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 692 796 3.0E-10
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 692 796 4.0E-10
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 624 837 5.0E-10
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 692 788 5.0E-10
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 1125 1206 2.0E-09
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 663 761 2.0E-06
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1409 1486 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079510
MASAVLPLLNSVPVLTGADNYDSWKRNMRNILTLLQADGSSCSALDMCEDTATTTNDPAEVAKRAQVQKIAIAAI
NTRIAEGLISISYTSVRDLWVALENTYGTAGPAAIYSMYQQTLGFAISGNKDPSAEIANLEQLYNRLQSAGVDIP
ALVRAMTLLGSVPSSWNIASSFLAAKSSVNDVTYQNVRAAILTEFNQRRTSQAQANRFSGMRRGNQKPQWKSQDN
QQQQQQQQRQQQQRPQGQQQQQPQGEQPKKKTRRGKRKNDNQNANEATTSGIEEYTAQSVTQFASPASLLHRISS
PTCDPRPRPSPYPKPHPIGRFETAKARVWKQKGKEIEEKNAMEVDPIDEAITEHFSAPQDDDDAILLGSSASEYD
WYVTSPRRSEINDAIQSCISNPLHVDRTCSCLNTFAYASPSYECDKPECKKCGKQPAHDTKYPTEWLLDSGASCH
FTSVLDDFIEHEMGNFGYVGTAEAGKVLPITARGTVMFEHEVVNHRTGEVHVLTSTIAPVYYCKGMGGRILSTNT
FLQNGVTMSASENFTTLLDPSGSPILSAKRGIGCCKNNLHFVFCRIIKNSGHVNRSVQDPSYEIWHQRFGHASDD
ALKRVPESSKTPVKIDFPRKKSTCPGCALGKQHQKTFSENPQRATHFGELIHSDLLEFPIQSYHKYKWAITFLDD
YSSAVSIALLRSKSQALKALKDFVALISTQHDAKVKRFRTDNGGEYVSQELDDFFKSKGIIHETTAPYAHQQNGR
AERLNRTLLDKIRAMMTNACIPESYWEFAIQTAVHVYNRTPMRRIGWKSPSELWYGVKPDVSRLRVFGCGAYVFI
PEEKRNNKLEPRSELMLFVGYTSGGANYLFIRHTKNNAEFVSPTAIFEETYFPKCPKTDPRGYPRRAPSVPNDDD
DNSRDVDPPSAPAPFGFGGDPSKPLPPTPPRARSPSIPSSGPSRPRTPSRPPSPQQEAPPPRVPQPGPSEPRRSG
RQRRAPLRPGNVYGDRSDPGEAERHPRERDVRRPYPPEGVVIGPQEERFRRSFPYRERRAREYERRPRWNPGGAQ
PPVNPEVHPPSEPSQERSPNPDMGQSRDPMEDLQRIVHEGGLEFIEFLMANAVAKSKTPIQFKDLADLSPSDRKA
WLDTCLEELQALKKRGVYELIDLPKGRRAIKNRWVFNTKSDGRKRARLVTKGFSQIKGVDFDELFSPVVCYETAR
LLLGVAALEDWEIESVDVKTAYLYGKLDEEIYMEQPEGFRLKGKENKVWRLHRALYGLKQAGLAWWRELTTSMKE
LGFKRCESDAGVYYYRCPKTAQLIIALVYVDDVAILGKRTSLFKSLKDSFMKKWECRDLGACKEFLGMSISRDRK
NQKIYLDQVEYLDKVLEKFNVTAKPTKTPLASGFSFLPNSEPANPMFRQKYQQLVGSLMYLTIGSQPDIAYAVVK
LSQQCANPAPEHYEAGLYVLRYLLATRKYRMVFDGSSNEAIVAYSDSDWAQDSTDRKSVTGNYVTLASGCVSWLS
RRQKTVAASSTEAEYMALSDCSKQLVWMHQLLSEIGLSCPTPHLIGDNQGSIFWASNPVQEKRSKHIDVKYHIVR
QYVEDKKIELFWVDGTKNPADIFTKNLDKTKFERIRSLLGMEFFAQ*
Coding >AgabiH97|079510
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTACGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCTAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGCGCATCGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTGCGCGACCTTTGGGTTGCCCTGGAGAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCCGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAATCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAGCCTCAGGGT
GAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAATCAGAATGCGAACGAGGCCACTACATCT
GGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCCGCATCATTGCTTCATCGTATCTCTTCC
CCAACTTGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCATCCTATTGGGCGATTCGAAACTGCCAAG
GCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCAATGGAAGTAGATCCCATCGACGAGGCG
ATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTTGCTCGGTTCGTCCGCTTCTGAGTATGAT
TGGTATGTGACTTCACCTCGTAGAAGTGAAATTAATGACGCAATACAGTCCTGCATCTCCAACCCTCTACATGTA
GATCGGACTTGTTCTTGTTTAAATACATTTGCTTATGCGTCTCCTTCTTACGAGTGTGATAAACCTGAGTGCAAA
AAATGTGGGAAACAGCCTGCTCATGACACTAAATATCCAACTGAGTGGCTCCTCGATTCTGGAGCATCCTGCCAC
TTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATATGTAGGGACTGCTGAAGCGGGA
AAGGTCCTTCCGATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGTGAACCATCGAACTGGTGAAGTC
CATGTTTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGCCGCATTCTGTCCACCAATACG
TTTCTGCAAAATGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTCGATCCCTCAGGATCTCCCATC
CTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTCTGTCGGATTATTAAAAACTCC
GGACATGTGAACCGATCAGTTCAAGATCCATCTTATGAGATCTGGCACCAGAGATTTGGGCATGCATCGGATGAC
GCCCTGAAAAGGGTACCTGAATCTTCAAAAACACCTGTAAAAATCGATTTCCCTCGGAAGAAATCTACATGTCCT
GGGTGCGCTCTTGGTAAGCAGCACCAGAAGACCTTCTCCGAGAATCCCCAAAGGGCAACTCATTTTGGAGAATTG
ATTCATTCTGATCTTCTTGAGTTCCCGATCCAATCGTACCATAAATACAAATGGGCGATAACATTCCTTGATGAT
TATTCATCAGCCGTCTCCATCGCATTATTGCGTTCAAAATCGCAGGCACTAAAAGCTCTGAAGGACTTTGTTGCT
TTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGCGGCGAATACGTATCTCAGGAA
TTGGATGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTACGCGCACCAACAGAACGGTCGC
GCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAATGCGTGCATTCCTGAGTCATAC
TGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCAATGCGACGGATTGGATGGAAATCACCA
TCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGCTGTGGGGCATATGTTTTTATC
CCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCCGAGTTAATGCTCTTTGTTGGTTACACTTCTGGAGGA
GCAAACTACCTATTCATCAGGCACACTAAAAATAATGCCGAGTTTGTTTCTCCTACAGCCATTTTTGAAGAAACA
TATTTCCCGAAATGTCCCAAGACTGATCCTAGAGGATATCCGAGACGAGCTCCGTCAGTCCCTAATGATGACGAT
GACAACTCACGAGATGTGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGTGGCGACCCTAGTAAGCCACTC
CCACCTACTCCACCTAGGGCTCGATCGCCCTCCATTCCGAGTTCTGGCCCTTCAAGGCCGAGAACCCCATCTAGA
CCACCTTCACCGCAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCGAGTGAACCACGGAGATCTGGT
AGACAACGCCGTGCCCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGATCCAGGTGAAGCTGAACGACAC
CCCCGTGAACGTGATGTCCGACGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGT
CGCTCCTTCCCCTATAGAGAACGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAG
CCCCCAGTCAACCCTGAAGTACATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATCCAGATATGGGACAA
TCTAGAGATCCCATGGAGGACTTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCC
AATGCCGTCGCCAAGTCCAAAACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCT
TGGCTTGACACATGCCTTGAAGAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAA
GGTCGTAGAGCGATCAAAAATAGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGACT
AAAGGTTTCTCCCAGATCAAAGGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCTGTTATGAAACGGCACGC
CTCCTACTCGGTGTTGCAGCACTTGAGGATTGGGAAATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGT
AAACTGGATGAAGAAATCTACATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGA
TTACACCGAGCTCTTTACGGCCTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAA
CTAGGCTTTAAGCGCTGTGAATCAGATGCCGGTGTCTATTATTACCGCTGCCCGAAAACGGCGCAACTTATCATA
GCACTTGTCTATGTTGACGATGTCGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTC
ATGAAGAAGTGGGAATGTCGCGATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAG
AACCAGAAAATATACCTTGACCAGGTCGAGTATCTTGATAAGGTCCTTGAGAAATTCAACGTCACTGCGAAGCCG
ACGAAGACTCCTCTCGCGTCCGGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAATGTTTCGCCAAAAA
TACCAACAACTTGTGGGATCTTTGATGTATCTGACGATCGGTTCCCAACCAGACATCGCTTACGCCGTTGTTAAG
CTGAGCCAACAGTGTGCAAACCCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTTGCT
ACGCGCAAGTACAGAATGGTGTTTGACGGGTCGTCAAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCT
CAAGATTCCACTGACCGCAAATCTGTCACAGGTAACTACGTAACTCTTGCTTCTGGGTGTGTTTCCTGGTTGAGC
AGACGTCAAAAGACTGTGGCCGCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTT
GTTTGGATGCACCAGCTGCTATCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGG
TCCATTTTCTGGGCATCTAACCCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGT
CAATATGTCGAGGACAAAAAGATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCCGACATCTTCACCAAA
AATCTCGACAAGACTAAATTCGAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA
Transcript >AgabiH97|079510
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTACGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCTAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGCGCATCGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTGCGCGACCTTTGGGTTGCCCTGGAGAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCCGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAATCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAGCCTCAGGGT
GAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAATCAGAATGCGAACGAGGCCACTACATCT
GGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCCGCATCATTGCTTCATCGTATCTCTTCC
CCAACTTGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCATCCTATTGGGCGATTCGAAACTGCCAAG
GCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCAATGGAAGTAGATCCCATCGACGAGGCG
ATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTTGCTCGGTTCGTCCGCTTCTGAGTATGAT
TGGTATGTGACTTCACCTCGTAGAAGTGAAATTAATGACGCAATACAGTCCTGCATCTCCAACCCTCTACATGTA
GATCGGACTTGTTCTTGTTTAAATACATTTGCTTATGCGTCTCCTTCTTACGAGTGTGATAAACCTGAGTGCAAA
AAATGTGGGAAACAGCCTGCTCATGACACTAAATATCCAACTGAGTGGCTCCTCGATTCTGGAGCATCCTGCCAC
TTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATATGTAGGGACTGCTGAAGCGGGA
AAGGTCCTTCCGATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGTGAACCATCGAACTGGTGAAGTC
CATGTTTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGCCGCATTCTGTCCACCAATACG
TTTCTGCAAAATGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTCGATCCCTCAGGATCTCCCATC
CTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTCTGTCGGATTATTAAAAACTCC
GGACATGTGAACCGATCAGTTCAAGATCCATCTTATGAGATCTGGCACCAGAGATTTGGGCATGCATCGGATGAC
GCCCTGAAAAGGGTACCTGAATCTTCAAAAACACCTGTAAAAATCGATTTCCCTCGGAAGAAATCTACATGTCCT
GGGTGCGCTCTTGGTAAGCAGCACCAGAAGACCTTCTCCGAGAATCCCCAAAGGGCAACTCATTTTGGAGAATTG
ATTCATTCTGATCTTCTTGAGTTCCCGATCCAATCGTACCATAAATACAAATGGGCGATAACATTCCTTGATGAT
TATTCATCAGCCGTCTCCATCGCATTATTGCGTTCAAAATCGCAGGCACTAAAAGCTCTGAAGGACTTTGTTGCT
TTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGCGGCGAATACGTATCTCAGGAA
TTGGATGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTACGCGCACCAACAGAACGGTCGC
GCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAATGCGTGCATTCCTGAGTCATAC
TGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCAATGCGACGGATTGGATGGAAATCACCA
TCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGCTGTGGGGCATATGTTTTTATC
CCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCCGAGTTAATGCTCTTTGTTGGTTACACTTCTGGAGGA
GCAAACTACCTATTCATCAGGCACACTAAAAATAATGCCGAGTTTGTTTCTCCTACAGCCATTTTTGAAGAAACA
TATTTCCCGAAATGTCCCAAGACTGATCCTAGAGGATATCCGAGACGAGCTCCGTCAGTCCCTAATGATGACGAT
GACAACTCACGAGATGTGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGTGGCGACCCTAGTAAGCCACTC
CCACCTACTCCACCTAGGGCTCGATCGCCCTCCATTCCGAGTTCTGGCCCTTCAAGGCCGAGAACCCCATCTAGA
CCACCTTCACCGCAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCGAGTGAACCACGGAGATCTGGT
AGACAACGCCGTGCCCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGATCCAGGTGAAGCTGAACGACAC
CCCCGTGAACGTGATGTCCGACGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGT
CGCTCCTTCCCCTATAGAGAACGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAG
CCCCCAGTCAACCCTGAAGTACATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATCCAGATATGGGACAA
TCTAGAGATCCCATGGAGGACTTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCC
AATGCCGTCGCCAAGTCCAAAACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCT
TGGCTTGACACATGCCTTGAAGAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAA
GGTCGTAGAGCGATCAAAAATAGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGACT
AAAGGTTTCTCCCAGATCAAAGGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCTGTTATGAAACGGCACGC
CTCCTACTCGGTGTTGCAGCACTTGAGGATTGGGAAATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGT
AAACTGGATGAAGAAATCTACATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGA
TTACACCGAGCTCTTTACGGCCTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAA
CTAGGCTTTAAGCGCTGTGAATCAGATGCCGGTGTCTATTATTACCGCTGCCCGAAAACGGCGCAACTTATCATA
GCACTTGTCTATGTTGACGATGTCGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTC
ATGAAGAAGTGGGAATGTCGCGATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAG
AACCAGAAAATATACCTTGACCAGGTCGAGTATCTTGATAAGGTCCTTGAGAAATTCAACGTCACTGCGAAGCCG
ACGAAGACTCCTCTCGCGTCCGGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAATGTTTCGCCAAAAA
TACCAACAACTTGTGGGATCTTTGATGTATCTGACGATCGGTTCCCAACCAGACATCGCTTACGCCGTTGTTAAG
CTGAGCCAACAGTGTGCAAACCCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTTGCT
ACGCGCAAGTACAGAATGGTGTTTGACGGGTCGTCAAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCT
CAAGATTCCACTGACCGCAAATCTGTCACAGGTAACTACGTAACTCTTGCTTCTGGGTGTGTTTCCTGGTTGAGC
AGACGTCAAAAGACTGTGGCCGCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTT
GTTTGGATGCACCAGCTGCTATCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGG
TCCATTTTCTGGGCATCTAACCCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGT
CAATATGTCGAGGACAAAAAGATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCCGACATCTTCACCAAA
AATCTCGACAAGACTAAATTCGAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA
Gene >AgabiH97|079510
ATGGCCTCTGCTGTTCTCCCCCTCCTCAACTCTGTTCCGGTCCTCACTGGCGCCGATAATTACGACTCTTGGAAG
CGTAACATGAGGAACATCCTCACCTTGCTCCAAGCTGATGGGTCTAGTTGCTCTGCACTTGACATGTGCGAGGAC
ACTGCAACTACAACCAACGATCCTGCCGAAGTAGCCAAAAGGGCTCAAGTCCAAAAGATAGCGATTGCTGCGATA
AACACGCGCATCGCTGAGGGCTTGATCTCGATCTCGTATACCTCAGTGCGCGACCTTTGGGTTGCCCTGGAGAAT
ACGTATGGTACTGCTGGCCCTGCCGCAATCTATTCAATGTACCAACAGACCCTAGGCTTCGCTATTTCTGGCAAC
AAGGATCCGTCAGCCGAGATCGCTAATCTCGAGCAGCTTTACAACCGCCTCCAGTCTGCCGGTGTTGACATTCCG
GCCCTCGTTCGAGCCATGACTCTTCTTGGCTCTGTTCCTTCTTCTTGGAACATCGCATCTTCTTTTCTTGCCGCC
AAGTCGTCGGTTAACGACGTTACTTATCAGAATGTGCGCGCCGCCATCTTGACTGAATTTAATCAGCGCCGCACT
TCTCAAGCGCAAGCTAATAGGTTTTCTGGCATGAGGCGTGGCAATCAAAAGCCACAATGGAAGTCGCAAGACAAC
CAGCAGCAGCAGCAGCAACAGCAACGACAGCAGCAGCAGCGACCGCAAGGTCAGCAGCAGCAGCAGCCTCAGGGT
GAGCAGCCCAAAAAGAAAACTCGTCGCGGCAAACGTAAGAACGATAATCAGAATGCGAACGAGGCCACTACATCT
GGCATCGAAGAGTACACGGCCCAATCCGTGACACAGTTCGCTTCCCCCGCATCATTGCTTCATCGTATCTCTTCC
CCAACTTGTGACCCTCGTCCGAGACCGAGCCCCTATCCGAAGCCTCATCCTATTGGGCGATTCGAAACTGCCAAG
GCTCGGGTCTGGAAACAAAAAGGGAAGGAGATCGAAGAAAAGAACGCAATGGAAGTAGATCCCATCGACGAGGCG
ATCACTGAACATTTCAGCGCTCCTCAGGATGACGACGATGCGATCTTGCTCGGTTCGTCCGCTTCTGAGTATGAT
TGGTATGTGACTTCACCTCGTAGAAGTGAAATTAATGACGCAATACAGTCCTGCATCTCCAACCCTCTACATGTA
GATCGGACTTGTTCTTGTTTAAATACATTTGCTTATGCGTCTCCTTCTTACGAGTGTGATAAACCTGAGTGCAAA
AAATGTGGGAAACAGCCTGCTCATGACACTAAATATCCAACTGAGTGGCTCCTCGATTCTGGAGCATCCTGCCAC
TTTACCAGTGTGTTGGATGACTTCATCGAGCACGAAATGGGAAATTTCGGATATGTAGGGACTGCTGAAGCGGGA
AAGGTCCTTCCGATCACCGCTCGTGGAACCGTCATGTTTGAGCATGAAGTTGTGAACCATCGAACTGGTGAAGTC
CATGTTTTGACTTCGACAATTGCTCCTGTCTATTATTGCAAGGGCATGGGGGGCCGCATTCTGTCCACCAATACG
TTTCTGCAAAATGGTGTGACAATGTCTGCCTCTGAGAACTTTACTACGCTCCTCGATCCCTCAGGATCTCCCATC
CTTTCAGCCAAACGAGGCATAGGATGTTGCAAAAATAATCTCCACTTCGTGTTCTGTCGGATTATTAAAAACTCC
GGACATGTGAACCGATCAGTTCAAGATCCATCTTATGAGATCTGGCACCAGAGATTTGGGCATGCATCGGATGAC
GCCCTGAAAAGGGTACCTGAATCTTCAAAAACACCTGTAAAAATCGATTTCCCTCGGAAGAAATCTACATGTCCT
GGGTGCGCTCTTGGTAAGCAGCACCAGAAGACCTTCTCCGAGAATCCCCAAAGGGCAACTCATTTTGGAGAATTG
ATTCATTCTGATCTTCTTGAGTTCCCGATCCAATCGTACCATAAATACAAATGGGCGATAACATTCCTTGATGAT
TATTCATCAGCCGTCTCCATCGCATTATTGCGTTCAAAATCGCAGGCACTAAAAGCTCTGAAGGACTTTGTTGCT
TTGATTAGCACCCAACATGATGCTAAGGTGAAGCGTTTCAGAACCGACAATGGCGGCGAATACGTATCTCAGGAA
TTGGATGACTTCTTTAAGTCAAAGGGGATAATCCATGAAACAACCGCACCTTACGCGCACCAACAGAACGGTCGC
GCTGAGAGATTGAATCGCACCTTACTCGATAAGATAAGGGCCATGATGACAAATGCGTGCATTCCTGAGTCATAC
TGGGAATTTGCGATTCAAACGGCTGTGCATGTCTATAATCGCACGCCAATGCGACGGATTGGATGGAAATCACCA
TCTGAGTTATGGTACGGTGTAAAACCGGATGTCTCTCGACTCCGTGTTTTTGGCTGTGGGGCATATGTTTTTATC
CCAGAGGAGAAACGTAACAACAAACTTGAGCCTCGTTCCGAGTTAATGCTCTTTGTTGGTTACACTTCTGGAGGA
GCAAACTACCTATTCATCAGGCACACTAAAAATAATGCCGAGTTTGTTTCTCCTACAGCCATTTTTGAAGAAACA
TATTTCCCGAAATGTCCCAAGACTGATCCTAGAGGATATCCGAGACGAGCTCCGTCAGTCCCTAATGATGACGAT
GACAACTCACGAGATGTGGATCCACCCTCCGCTCCAGCTCCATTTGGGTTTGGTGGCGACCCTAGTAAGCCACTC
CCACCTACTCCACCTAGGGCTCGATCGCCCTCCATTCCGAGTTCTGGCCCTTCAAGGCCGAGAACCCCATCTAGA
CCACCTTCACCGCAGCAAGAAGCACCTCCGCCTCGTGTTCCTCAGCCTGGTCCGAGTGAACCACGGAGATCTGGT
AGACAACGCCGTGCCCCACTGCGTCCTGGTAACGTTTACGGTGATCGATCTGATCCAGTTGAGGATCTCAAAAAT
GACTTTGATGATCTCCTTGATAAGATCTGAGCACAGGGTGAAGCTGAACGACACCCCCGTGAACGTGATGTCCGA
CGTCCATACCCTCCTGAAGGAGTGGTAATAGGGCCGCAAGAAGAGCGCTTTCGTCGCTCCTTCCCCTATAGAGAA
CGTCGTGCCAGAGAATATGAAAGGCGTCCACGATGGAATCCTGGAGGAGCACAGCCCCCAGTCAACCCTGAAGTA
CATCCTCCGAGCGAACCTTCCCAGGAACGCTCTCCAAATCCAGATATGGGACAATCTAGAGATCCCATGGAGGAC
TTACAACGTATTGTCCATGAGGGGGGACTGGAATTTATCGAATTCTTAATGGCCAATGCCGTCGCCAAGTCCAAA
ACACCAATCCAATTCAAAGACTTAGCTGATCTATCTCCATCTGATCGCAAAGCTTGGCTTGACACATGCCTTGAA
GAGCTCCAAGCTCTTAAGAAACGTGGAGTATATGAATTGATTGATCTCCCAAAAGGTCGTAGAGCGATCAAAAAT
AGATGGGTATTTAACACGAAGTCTGATGGCCGGAAACGTGCTCGACTCGTGACTAAAGGTTTCTCCCAGATCAAA
GGAGTTGACTTCGATGAGTTATTTTCTCCCGTAGTCTGTTATGAAACGGCACGCCTCCTACTCGGTGTTGCAGCA
CTTGAGGATTGGGAAATTGAGAGCGTGGATGTAAAAACAGCATATCTCTACGGTAAACTGGATGAAGAAATCTAC
ATGGAGCAGCCTGAAGGCTTTCGCCTGAAAGGCAAAGAAAATAAAGTGTGGAGATTACACCGAGCTCTTTACGGC
CTGAAACAAGCTGGCTTGGCCTGGTGGCGTGAACTGACCACGTCCATGAAGGAACTAGGCTTTAAGCGCTGTGAA
TCAGATGCCGGTGTCTATTATTACCGCTGCCCGAAAACGGCGCAACTTATCATAGCACTTGTCTATGTTGACGAT
GTCGCTATCCTTGGCAAACGGACTTCGCTCTTCAAGAGTTTGAAGGACTCCTTCATGAAGAAGTGGGAATGTCGC
GATCTTGGAGCATGCAAAGAGTTCTTAGGAATGAGCATCTCTCGCGACAGGAAGAACCAGAAAATATACCTTGAC
CAGGTCGAGTATCTTGATAAGGTCCTTGAGAAATTCAACGTCACTGCGAAGCCGACGAAGACTCCTCTCGCGTCC
GGGTTCTCCTTCCTTCCAAATTCTGAACCGGCTAATCCAATGTTTCGCCAAAAATACCAACAACTTGTGGGATCT
TTGATGTATCTGACGATCGGTTCCCAACCAGACATCGCTTACGCCGTTGTTAAGCTGAGCCAACAGTGTGCAAAC
CCTGCACCTGAACACTATGAGGCAGGACTCTATGTTCTTCGATACCTCCTTGCTACGCGCAAGTACAGAATGGTG
TTTGACGGGTCGTCAAATGAGGCAATTGTTGCTTACTCCGACTCTGATTGGGCTCAAGATTCCACTGACCGCAAA
TCTGTCACAGGTAACTACGTAACTCTTGCTTCTGGGTGTGTTTCCTGGTTGAGCAGACGTCAAAAGACTGTGGCC
GCTTCTTCGACTGAGGCCGAATATATGGCGCTGTCAGATTGCTCTAAACAGCTTGTTTGGATGCACCAGCTGCTA
TCGGAAATAGGACTTAGTTGTCCAACTCCTCATTTGATTGGCGACAATCAAGGGTCCATTTTCTGGGCATCTAAC
CCTGTCCAAGAAAAACGCTCAAAGCACATTGACGTGAAATATCACATAGTCCGTCAATATGTCGAGGACAAAAAG
ATTGAATTATTTTGGGTTGATGGCACCAAGAATCCTGCCGACATCTTCACCAAAAATCTCGACAAGACTAAATTC
GAGCGTATTCGATCCCTACTAGGTATGGAATTCTTTGCGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail