Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|079100
Gene name
Locationscaffold_5:233995..235336
Strand+
Gene length (bp)1341
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 9.0E-09 65 326

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 32.22 16.34 48.10
Initials Initials knots 44.72 25.49 63.94
Pileal_Stipeal_center Stage I stipe center 20.01 10.32 29.70
Pileal_Stipeal_shell Stage I stipe shell 26.71 14.21 39.21
DIF_stipe_center Stage II stipe center 15.04 7.47 22.62
DIF_stipe_shell Stage II stipe shell 11.49 5.48 17.50
DIF_stipe_skin Stage II stipe skin 16.08 8.03 24.13
DIF_cap_skin Stage II cap skin 25.12 13.34 36.90
DIF_cap_tissue Stage II cap tissue 29.27 15.85 42.70
DIF_gill_tissue Stage II gill tissue 29.51 16.00 43.01
YFB_stipe_center Young fruiting body stipe center 12.07 5.76 18.38
YFB_stipe_shell Young fruiting body stipe shell 9.43 4.34 14.52
YFB_stipe_skin Young fruiting body stipe skin 14.27 7.02 21.53
YFB_cap_skin Young fruiting body cap skin 23.51 12.37 34.65
YFB_cap_tissue Young fruiting body cap tissue 28.60 15.40 41.80
YFB_gill_tissue Young fruiting body gill tissue 27.88 14.56 41.19
YFB_veil Young fruiting body veil 23.25 12.21 34.28

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.877923 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.010412 yes
Casing YFB_cap_skin 0.426625 no
Casing YFB_cap_tissue 0.823923 no
Casing YFB_gill_tissue 0.777889 no
Casing YFB_veil 0.411194 no
Casing Initials 0.372239 no
Casing Pileal_Stipeal_center 0.179208 no
Casing Pileal_Stipeal_shell 0.696474 no
Casing DIF_stipe_center 0.014668 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.031557 yes
Casing DIF_cap_skin 0.567045 no
Casing DIF_cap_tissue 0.865196 no
DIF_gill_tissue YFB_stipe_center 0.002525 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.022892 yes
DIF_gill_tissue YFB_cap_skin 0.599792 no
DIF_gill_tissue YFB_cap_tissue 0.959321 no
DIF_gill_tissue YFB_gill_tissue 0.923755 no
DIF_gill_tissue YFB_veil 0.578239 no
YFB_stipe_center YFB_stipe_shell 0.627627 no
YFB_stipe_center YFB_stipe_skin 0.753117 no
YFB_stipe_center YFB_cap_skin 0.046117 yes
YFB_stipe_center YFB_cap_tissue 0.004160 yes
YFB_stipe_center YFB_gill_tissue 0.006742 yes
YFB_stipe_center YFB_veil 0.051318 no
YFB_stipe_shell YFB_stipe_skin 0.306903 no
YFB_stipe_shell YFB_cap_skin 0.005302 yes
YFB_stipe_shell YFB_cap_tissue 0.001140 yes
YFB_stipe_shell YFB_gill_tissue 0.001140 yes
YFB_stipe_shell YFB_veil 0.007439 yes
YFB_stipe_skin YFB_cap_skin 0.150844 no
YFB_stipe_skin YFB_cap_tissue 0.026215 yes
YFB_stipe_skin YFB_gill_tissue 0.033211 yes
YFB_stipe_skin YFB_veil 0.165164 no
YFB_cap_skin YFB_cap_tissue 0.671893 no
YFB_cap_skin YFB_gill_tissue 0.726706 no
YFB_cap_skin YFB_veil 0.985688 no
YFB_cap_tissue YFB_gill_tissue 0.966803 no
YFB_cap_tissue YFB_veil 0.647578 no
YFB_gill_tissue YFB_veil 0.703809 no
Initials DIF_gill_tissue 0.210892 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.029164 yes
Initials YFB_cap_tissue 0.162096 no
Initials YFB_gill_tissue 0.137455 no
Initials YFB_veil 0.027943 yes
Initials Pileal_Stipeal_center 0.006032 yes
Initials Pileal_Stipeal_shell 0.096942 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.059318 no
Initials DIF_cap_tissue 0.189160 no
Pileal_Stipeal_center DIF_gill_tissue 0.295336 no
Pileal_Stipeal_center YFB_stipe_center 0.155303 no
Pileal_Stipeal_center YFB_stipe_shell 0.033674 yes
Pileal_Stipeal_center YFB_stipe_skin 0.407303 no
Pileal_Stipeal_center YFB_cap_skin 0.753958 no
Pileal_Stipeal_center YFB_cap_tissue 0.346623 no
Pileal_Stipeal_center YFB_gill_tissue 0.402444 no
Pileal_Stipeal_center YFB_veil 0.776605 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.493038 no
Pileal_Stipeal_center DIF_stipe_center 0.507062 no
Pileal_Stipeal_center DIF_stipe_shell 0.114271 no
Pileal_Stipeal_center DIF_stipe_skin 0.654120 no
Pileal_Stipeal_center DIF_cap_skin 0.618905 no
Pileal_Stipeal_center DIF_cap_tissue 0.304208 no
Pileal_Stipeal_shell DIF_gill_tissue 0.857613 no
Pileal_Stipeal_shell YFB_stipe_center 0.009123 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.003365 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.054982 no
Pileal_Stipeal_shell YFB_cap_skin 0.808997 no
Pileal_Stipeal_shell YFB_cap_tissue 0.907652 no
Pileal_Stipeal_shell YFB_gill_tissue 0.944848 no
Pileal_Stipeal_shell YFB_veil 0.789460 no
Pileal_Stipeal_shell DIF_stipe_center 0.083843 no
Pileal_Stipeal_shell DIF_stipe_shell 0.006032 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.150034 no
Pileal_Stipeal_shell DIF_cap_skin 0.920251 no
Pileal_Stipeal_shell DIF_cap_tissue 0.870791 no
DIF_stipe_center DIF_gill_tissue 0.034142 yes
DIF_stipe_center YFB_stipe_center 0.658639 no
DIF_stipe_center YFB_stipe_shell 0.243427 no
DIF_stipe_center YFB_stipe_skin 0.936725 no
DIF_stipe_center YFB_cap_skin 0.216986 no
DIF_stipe_center YFB_cap_tissue 0.042475 yes
DIF_stipe_center YFB_gill_tissue 0.058732 no
DIF_stipe_center YFB_veil 0.229477 no
DIF_stipe_center DIF_stipe_shell 0.561898 no
DIF_stipe_center DIF_stipe_skin 0.921415 no
DIF_stipe_center DIF_cap_skin 0.141124 no
DIF_stipe_center DIF_cap_tissue 0.035076 yes
DIF_stipe_shell DIF_gill_tissue 0.003765 yes
DIF_stipe_shell YFB_stipe_center 0.941994 no
DIF_stipe_shell YFB_stipe_shell 0.722449 no
DIF_stipe_shell YFB_stipe_skin 0.662908 no
DIF_stipe_shell YFB_cap_skin 0.034837 yes
DIF_stipe_shell YFB_cap_tissue 0.004928 yes
DIF_stipe_shell YFB_gill_tissue 0.005671 yes
DIF_stipe_shell YFB_veil 0.039836 yes
DIF_stipe_shell DIF_stipe_skin 0.441367 no
DIF_stipe_shell DIF_cap_skin 0.021056 yes
DIF_stipe_shell DIF_cap_tissue 0.003765 yes
DIF_stipe_skin DIF_gill_tissue 0.066767 no
DIF_stipe_skin YFB_stipe_center 0.528107 no
DIF_stipe_skin YFB_stipe_shell 0.165164 no
DIF_stipe_skin YFB_stipe_skin 0.842728 no
DIF_stipe_skin YFB_cap_skin 0.323512 no
DIF_stipe_skin YFB_cap_tissue 0.081756 no
DIF_stipe_skin YFB_gill_tissue 0.105864 no
DIF_stipe_skin YFB_veil 0.348395 no
DIF_stipe_skin DIF_cap_skin 0.221377 no
DIF_stipe_skin DIF_cap_tissue 0.069013 no
DIF_cap_skin DIF_gill_tissue 0.745010 no
DIF_cap_skin YFB_stipe_center 0.023415 yes
DIF_cap_skin YFB_stipe_shell 0.005302 yes
DIF_cap_skin YFB_stipe_skin 0.090997 no
DIF_cap_skin YFB_cap_skin 0.911320 no
DIF_cap_skin YFB_cap_tissue 0.805790 no
DIF_cap_skin YFB_gill_tissue 0.851688 no
DIF_cap_skin YFB_veil 0.895824 no
DIF_cap_skin DIF_cap_tissue 0.759663 no
DIF_cap_tissue DIF_gill_tissue 0.990426 no
DIF_cap_tissue YFB_stipe_center 0.001140 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.021583 yes
DIF_cap_tissue YFB_cap_skin 0.617596 no
DIF_cap_tissue YFB_cap_tissue 0.970196 no
DIF_cap_tissue YFB_gill_tissue 0.935804 no
DIF_cap_tissue YFB_veil 0.593603 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|079100
MYLDSLAIIIAFARILSASFLNQIPFPAPPPNGDIHLAINPTCGQLSGDTADINAGIDKHSIKTIISFGDSYTDG
GKSDGSPLDPPILVFPNPLAGGRSTNGLTWVENVANDLNATIKDYAQAGACIDLKLWPSNPRKIDFLGQMKTFLG
QNNALDPNTTLYSIFFGINDYLASLIDGDHLTEAAQVLLDQIKILASPPTNARKFMVLDVYGRGTTIPSGETFKQ
IIYSGLSSFRVNGIQIINDDKHQPQRVTLDISYINFANIWKGVLGPNPGFEKFGYVSEDACTKCTAELGCTTIGM
CDDPEHYFYWIPGHPSKETMRIMADYVREVWDQCGV*
Coding >AgabiH97|079100
ATGTATCTCGACTCCCTCGCCATTATCATTGCCTTTGCTCGTATCCTCTCCGCCTCTTTTCTCAACCAAATTCCA
TTCCCAGCACCCCCTCCAAACGGCGACATCCATCTCGCCATCAATCCAACCTGTGGTCAACTTTCTGGCGACACT
GCAGATATCAATGCTGGTATAGACAAACACTCAATCAAGACCATAATCTCGTTCGGAGACAGTTACACCGACGGT
GGTAAATCCGACGGATCACCACTCGATCCTCCTATCCTAGTCTTCCCCAATCCTCTCGCAGGTGGCAGATCCACC
AACGGCCTAACCTGGGTCGAGAACGTTGCAAACGACCTTAACGCAACCATCAAAGACTACGCACAAGCTGGAGCT
TGTATTGATTTGAAATTATGGCCTAGTAACCCGCGTAAAATTGATTTTCTTGGTCAAATGAAGACTTTTCTTGGA
CAGAATAACGCTTTAGATCCCAATACCACACTATACAGTATATTTTTCGGAATCAACGACTATCTCGCCTCACTC
ATTGACGGCGATCATTTGACCGAAGCAGCACAAGTCCTCCTTGACCAAATCAAGATTCTAGCTTCTCCACCTACA
AACGCTCGTAAATTCATGGTTTTAGACGTTTACGGTCGAGGAACAACTATTCCTTCTGGTGAAACTTTCAAACAA
ATCATTTATTCTGGTTTAAGTTCTTTTCGAGTCAATGGTATCCAAATCATCAATGACGACAAACATCAACCTCAA
CGTGTGACTCTGGATATCTCATATATCAACTTTGCTAATATATGGAAGGGAGTTCTTGGTCCTAATCCTGGGTTT
GAGAAATTTGGATATGTGAGTGAGGACGCGTGTACGAAGTGTACGGCAGAGTTGGGGTGTACGACTATTGGGATG
TGTGATGATCCTGAACATTATTTTTATTGGATTCCTGGACATCCGTCGAAGGAGACTATGAGGATTATGGCGGAT
TATGTGAGGGAGGTTTGGGATCAATGTGGAGTCTAG
Transcript >AgabiH97|079100
ATGTATCTCGACTCCCTCGCCATTATCATTGCCTTTGCTCGTATCCTCTCCGCCTCTTTTCTCAACCAAATTCCA
TTCCCAGCACCCCCTCCAAACGGCGACATCCATCTCGCCATCAATCCAACCTGTGGTCAACTTTCTGGCGACACT
GCAGATATCAATGCTGGTATAGACAAACACTCAATCAAGACCATAATCTCGTTCGGAGACAGTTACACCGACGGT
GGTAAATCCGACGGATCACCACTCGATCCTCCTATCCTAGTCTTCCCCAATCCTCTCGCAGGTGGCAGATCCACC
AACGGCCTAACCTGGGTCGAGAACGTTGCAAACGACCTTAACGCAACCATCAAAGACTACGCACAAGCTGGAGCT
TGTATTGATTTGAAATTATGGCCTAGTAACCCGCGTAAAATTGATTTTCTTGGTCAAATGAAGACTTTTCTTGGA
CAGAATAACGCTTTAGATCCCAATACCACACTATACAGTATATTTTTCGGAATCAACGACTATCTCGCCTCACTC
ATTGACGGCGATCATTTGACCGAAGCAGCACAAGTCCTCCTTGACCAAATCAAGATTCTAGCTTCTCCACCTACA
AACGCTCGTAAATTCATGGTTTTAGACGTTTACGGTCGAGGAACAACTATTCCTTCTGGTGAAACTTTCAAACAA
ATCATTTATTCTGGTTTAAGTTCTTTTCGAGTCAATGGTATCCAAATCATCAATGACGACAAACATCAACCTCAA
CGTGTGACTCTGGATATCTCATATATCAACTTTGCTAATATATGGAAGGGAGTTCTTGGTCCTAATCCTGGGTTT
GAGAAATTTGGATATGTGAGTGAGGACGCGTGTACGAAGTGTACGGCAGAGTTGGGGTGTACGACTATTGGGATG
TGTGATGATCCTGAACATTATTTTTATTGGATTCCTGGACATCCGTCGAAGGAGACTATGAGGATTATGGCGGAT
TATGTGAGGGAGGTTTGGGATCAATGTGGAGTCTAG
Gene >AgabiH97|079100
ATGTATCTCGACTCCCTCGCCATTATCATTGCCTTTGCTCGTATCCTCTCCGCCTCTTTTCTCAACCAAATTCCA
TTCCCAGCACCCCCTCCAAACGGCGACATCCATCTCGCCATCAATCCAACCTGTGGTCAACTTTCTGGCGACACT
GCAGATATCAATGCTGGTATAGACAAACACTCAATCAAGACCATAATCTCGTTCGGAGCAAGTTCATTATTTCCT
ACAAACAACCGTCTCTCAACGTTAGACAGGACAGTTACACCGACGGTGGTAAATCCGACGGATCACCACTCGATC
CTCCTATCCTAGTCTTCCCCAATCCTCTCGCAGGTGGCAGATCCACCAACGGCCTAACCTGGGTCGAGAACGTTG
CAAACGACCTTAACGCAACCATCAAAGACTACGCAGTCAGTTTTTCTTCTTTCACGATATTCTTAGAAATTACTG
AATTGCTAGATATAGCAAGCTGGAGCTTGTATTGATTTGAAATTATGGCCTAGTAACCCGCGTAAAATTGATTTT
CTTGGTCAAAGTAAGAGAAACGCGAGTTTGAGATGTTTATGTGCTGATGGATTGGTAGTGAAGACTTTTCTTGGA
CAGAATAACGCTTTAGATCCCAATACCACACTATACAGTATATTTTTCGGAATCAAGTAAGTCTGCACACTCTTA
CCTCTTCGTGTTTTTAAACTCAAGCTTTTTCAACATAGCGACTATCTCGCCTCACTCAGTCAGTCAAACCAAAAA
ACAATTTCTTTTCTCAACTAAAATCTAAACCCTATTTACAGTTGACGGCGATCATTTGACCGAAGCAGCACAAGT
CCTCCTTGACCAAATCAAGATTCTAGCTTCTCCACCTACAAACGCTCGTAAATTCATGGTTTTAGACGTTTACGG
TCGAGGAACAACTATTCCTTCTGGTGAAACTTTCAAACAAATCATTTATTCTGGTTTAAGTTCTTTTCGAGTCAA
TGGTATCCAAATCATCAATGACGACAAACATCAACCTCAACGTGTGACTCTGGATATCTCATATATCAACTTTGC
TAATATATGGAAGGGAGTTCTTGGTCCTAATCCTGGGTTTGAGAAATTTGGATATGTGAGTGAGGACGCGTGTAC
GAAGTGTACGGCAGAGTTGGGGTGTACGACTATTGGGATGTGTGATGATCCTGAACATTATTTTTATTGGATTCC
TGGGTGAGTTTTTGCTATGAATATATATATATATATACGATGATGGTTGATGGTTTGGGATTTCAAAGACATCCG
TCGAAGGAGACTATGAGGATTATGGCGGATTATGTGAGGGAGGTTTGGGATCAATGTGGAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail