Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078900
Gene name
Locationscaffold_5:174632..176410
Strand+
Gene length (bp)1778
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 5.6E-21 37 157
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 1.4E-12 80 188
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.2E-08 32 101
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.4E-10 80 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 28 157 3.0E-12
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 28 157 3.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 45 157 4.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 45 157 5.0E-11
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 43 157 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 28 157 3.0E-12
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 28 157 3.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 45 157 4.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 45 157 5.0E-11
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 43 157 1.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 83 157 3.0E-07
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 45 114 3.0E-07
sp|A8W969|AGB34_AGAAL Beta-agarase AgaB34 OS=Agarivorans albus GN=agaB34 PE=3 SV=1 81 157 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 315.34 176.20 454.47
Initials Initials knots 492.73 255.62 729.84
Pileal_Stipeal_center Stage I stipe center 1117.02 480.39 1753.65
Pileal_Stipeal_shell Stage I stipe shell 388.19 210.69 565.70
DIF_stipe_center Stage II stipe center 1180.89 482.06 1879.71
DIF_stipe_shell Stage II stipe shell 1547.74 492.17 2603.30
DIF_stipe_skin Stage II stipe skin 851.94 375.67 1328.21
DIF_cap_skin Stage II cap skin 27.84 15.62 40.05
DIF_cap_tissue Stage II cap tissue 197.03 75.40 318.65
DIF_gill_tissue Stage II gill tissue 483.54 249.98 717.11
YFB_stipe_center Young fruiting body stipe center 692.03 331.05 1053.02
YFB_stipe_shell Young fruiting body stipe shell 1207.63 500.73 1914.52
YFB_stipe_skin Young fruiting body stipe skin 425.21 227.96 622.46
YFB_cap_skin Young fruiting body cap skin 15.24 7.92 22.56
YFB_cap_tissue Young fruiting body cap tissue 20.76 11.05 30.47
YFB_gill_tissue Young fruiting body gill tissue 423.64 175.05 672.24
YFB_veil Young fruiting body veil 481.04 137.26 824.83

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.201511 no
Casing YFB_stipe_center 0.015529 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.429259 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.487260 no
Casing YFB_veil 0.339569 no
Casing Initials 0.178332 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.618223 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.004548 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.216874 no
DIF_gill_tissue YFB_stipe_center 0.379747 no
DIF_gill_tissue YFB_stipe_shell 0.011659 yes
DIF_gill_tissue YFB_stipe_skin 0.807749 no
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.820143 no
DIF_gill_tissue YFB_veil 0.994125 no
YFB_stipe_center YFB_stipe_shell 0.163833 no
YFB_stipe_center YFB_stipe_skin 0.173347 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.216187 no
YFB_stipe_center YFB_veil 0.477294 no
YFB_stipe_shell YFB_stipe_skin 0.003365 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.004160 yes
YFB_stipe_shell YFB_veil 0.029164 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.995010 no
YFB_stipe_skin YFB_veil 0.849636 no
YFB_cap_skin YFB_cap_tissue 0.421541 no
YFB_cap_skin YFB_gill_tissue 0.000613 yes
YFB_cap_skin YFB_veil 0.000613 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.859779 no
Initials DIF_gill_tissue 0.976447 no
Initials YFB_stipe_center 0.404663 no
Initials YFB_stipe_shell 0.012274 yes
Initials YFB_stipe_skin 0.769326 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.784083 no
Initials YFB_veil 0.974219 no
Initials Pileal_Stipeal_center 0.014956 yes
Initials Pileal_Stipeal_shell 0.565027 no
Initials DIF_stipe_center 0.012274 yes
Initials DIF_stipe_shell 0.005302 yes
Initials DIF_stipe_skin 0.147418 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.007439 yes
Pileal_Stipeal_center DIF_gill_tissue 0.015819 yes
Pileal_Stipeal_center YFB_stipe_center 0.242768 no
Pileal_Stipeal_center YFB_stipe_shell 0.918414 no
Pileal_Stipeal_center YFB_stipe_skin 0.002951 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.004160 yes
Pileal_Stipeal_center YFB_veil 0.041603 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.941934 no
Pileal_Stipeal_center DIF_stipe_shell 0.565414 no
Pileal_Stipeal_center DIF_stipe_skin 0.610065 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.614692 no
Pileal_Stipeal_shell YFB_stipe_center 0.083328 no
Pileal_Stipeal_shell YFB_stipe_shell 0.001140 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.871309 no
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.887249 no
Pileal_Stipeal_shell YFB_veil 0.697394 no
Pileal_Stipeal_shell DIF_stipe_center 0.001140 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.001140 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.024187 yes
Pileal_Stipeal_shell DIF_cap_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.053150 no
DIF_stipe_center DIF_gill_tissue 0.008457 yes
DIF_stipe_center YFB_stipe_center 0.181928 no
DIF_stipe_center YFB_stipe_shell 0.978217 no
DIF_stipe_center YFB_stipe_skin 0.003365 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.003765 yes
DIF_stipe_center YFB_veil 0.029408 yes
DIF_stipe_center DIF_stipe_shell 0.662825 no
DIF_stipe_center DIF_stipe_skin 0.522093 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.005302 yes
DIF_stipe_shell YFB_stipe_center 0.066956 no
DIF_stipe_shell YFB_stipe_shell 0.703924 no
DIF_stipe_shell YFB_stipe_skin 0.001625 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.001625 yes
DIF_stipe_shell YFB_veil 0.008457 yes
DIF_stipe_shell DIF_stipe_skin 0.208336 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.133000 no
DIF_stipe_skin YFB_stipe_center 0.712595 no
DIF_stipe_skin YFB_stipe_shell 0.492977 no
DIF_stipe_skin YFB_stipe_skin 0.054575 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.068830 no
DIF_stipe_skin YFB_veil 0.224034 no
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.045911 yes
DIF_cap_skin YFB_cap_tissue 0.433827 no
DIF_cap_skin YFB_gill_tissue 0.000613 yes
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.000613 yes
DIF_cap_tissue DIF_gill_tissue 0.009123 yes
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.028437 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.039612 yes
DIF_cap_tissue YFB_veil 0.032038 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078900
MMQESFARKVVLAALIGALGVLAQQPDVPTYTGELVIQNIFDNGKCMTAASNSDGAAVTLQGCTGAASQKWVFQD
GSVKVHGNKCLDVSSGADANGTKMQIFTCSSGNANQQWSYDVWSKRLSWKGHNKCLDLSAGSTADGNRLQIWDCV
WNPNQFWNTGYLSNSLPQTSQAEQFGTNNCGTSSDQNSKCQTAWINSADDFCVWAPPALEAIGSSERYEVAWCTK
SGRGTRVIPDGTLKGVHFVETPDYVQITGQGDFTKINIPAGDAGGELDNRGADGRGNPIGGLVYGNSFGQGQQFH
EWTNFMSDHEFCFRACRGPRAMELCNHVFDEMGCYWNMPANYDPGFENCEGVDAEPMGVYTVDGQRSTYTQGQSP
TPPPHPAPSSSNCQALPTVSSSPVQARRALDRKFVPKFPEHTPAPSYF*
Coding >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACATACACCGGCGAGCTCGTTATTCAGAACATCTTCGATAATGGCAAATGCATGACCGCCGCA
TCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGTACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGAT
GGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTCTCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAG
ATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGGTCGTATGATGTTTGGAGTAAACGCTTATCCTGGAAA
GGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGACTTCAAATCTGGGATTGTGTC
TGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACAGTTC
GGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAATTCTGCCGATGAC
TTTTGCGTCTGGGCACCGCCTGCTCTGGAAGCCATTGGGAGTAGTGAACGCTACGAAGTCGCTTGGTGTACCAAA
TCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAAGGCGTCCATTTCGTCGAAACACCCGATTATGTA
CAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCAGCCGGTGATGCTGGAGGTGAACTTGATAACCGT
GGTGCTGATGGTAGAGGTAACCCCATTGGTGGATTAGTCTATGGCAATTCTTTCGGTCAAGGCCAGCAATTCCAT
GAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAGAGCCATGGAGCTCTGT
AACCATGTGTTTGACGAGATGGGCTGTTACTGGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAA
GGTGTCGACGCTGAACCGATGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCG
ACTCCCCCGCCTCATCCTGCTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAA
GCCCGACGTGCACTTGACAGGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA
Transcript >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACATACACCGGCGAGCTCGTTATTCAGAACATCTTCGATAATGGCAAATGCATGACCGCCGCA
TCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGTACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGAT
GGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTCTCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAG
ATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGGTCGTATGATGTTTGGAGTAAACGCTTATCCTGGAAA
GGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGACTTCAAATCTGGGATTGTGTC
TGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACAGTTC
GGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAATTCTGCCGATGAC
TTTTGCGTCTGGGCACCGCCTGCTCTGGAAGCCATTGGGAGTAGTGAACGCTACGAAGTCGCTTGGTGTACCAAA
TCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAAGGCGTCCATTTCGTCGAAACACCCGATTATGTA
CAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCAGCCGGTGATGCTGGAGGTGAACTTGATAACCGT
GGTGCTGATGGTAGAGGTAACCCCATTGGTGGATTAGTCTATGGCAATTCTTTCGGTCAAGGCCAGCAATTCCAT
GAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAGAGCCATGGAGCTCTGT
AACCATGTGTTTGACGAGATGGGCTGTTACTGGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAA
GGTGTCGACGCTGAACCGATGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCG
ACTCCCCCGCCTCATCCTGCTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAA
GCCCGACGTGCACTTGACAGGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA
Gene >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACGTTTGTCTTGATTGCGATTTTTCGACGTGTTTCTCTTGATGATTTTCTTTCAGATACACCG
GCGAGCTCGTTATTCAGAACATCTTCGATAATGGTGCGTGGCATGGTGCTCTTTCACTACATTGATTATTGATGC
CATCTTATTCTTTTAGGCAAATGCATGACCGCCGCATCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGT
ACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGATGGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTC
TCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAGATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGG
TCGTATGATGTTGTGAGTTGTTCGGTTATATGCTACTCTTGACGTGATGAGCGAGCATTGTTTTTAGTGGAGTAA
ACGCTTATCCTGGAAAGGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGAGTAAG
TACTTTGGTTTACACTTTCGTCTGTTCGCGATGTCATTCTTATGTGCACTTTTCAAAGCTTCAAATCTGGGATTG
TGTCTGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACA
GTTCGGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAAGTACGTTAA
TGAATGGTTCATTAATTTAACTTTAATCTCATTTAATTTAGTTCTGCCGATGACTTTTGCGTCTGGGCACCGCGT
AAGCCTTGATCATTAAGAAGCGTTAACCCTATACTTAATTATATTCGGTTAGCTGCTCTGGAAGCCATTGGGAGT
AGTGAACGCTACGAAGTCGCTTGGTGTACCAAATCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAA
GGCGTCCATTTCGTCGAAACACCCGATTATGTACAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCA
GCCGGTGATGCTGGAGGTGAACTTGATAACCGTGGTGCTGATGGTAGAGGTAACCCCAGTACGTTTTATCACCTC
TTCATGTTACTTCCGAAAGACTGAGATATGGTTCTTGATAGTTGGTGGATTAGTCTATGGCAATTCTTTCGGTCA
AGGCCAGCAATTCCATGAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAG
AGCCATGGAGCTCTGTAACCATGTGTTTGACGAGATGGGCTGTTACTGGGTACGTCGGTTGTTTATCCACTGCGA
ATTAGCCGAAATTTGACATTGAATGGTATAGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAAGG
TGTCGACGCGTAAGTTGCTCCCGTCTTGTCATCGCATAGATATAATGCTCATAACATCTTGCGCCAGTGAACCGA
TGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCGACTCCCCCGCCTCATCCTG
CTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAAGCCCGACGTGCACTTGACA
GGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail